Antibodies

Jump to Filters
View as table Download
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA308162

USD 415.00

In Stock

Rabbit Polyclonal antibody to Arginase I (arginase, liver)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089)
Arginase 1 (ARG1) (1-145) Rabbit Polyclonal Antibody
AP23580PU-N

USD 440.00

2 Weeks

Arginase 1 (ARG1) (1-145) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 145 of Human Arginase-1
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338396

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338397

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1. Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
CF502413

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
TA502413

USD 379.00

In Stock

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E6]
TA502413AM

USD 420.00

4 Weeks

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Arginase 1 (ARG1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E6]
TA502413BM

USD 420.00

4 Weeks

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
TA502413S

USD 159.00

In Stock

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: UMAB288]
UM800178CF

USD 528.00

4 Weeks

Carrier-free (BSA/glycerol-free) Arginase-1(ARG1) mouse monoclonal antibody, clone UMAB288

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: UMAB288]
UM870178

USD 180.00

In Stock

Arginase-1(ARG1) mouse monoclonal antibody, clone UMAB288

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".