Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPX4 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA |
Rabbit Polyclonal Anti-GSTM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTM2 antibody: synthetic peptide directed towards the N terminal of human GSTM2. Synthetic peptide located within the following region: TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF |
GSTT1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GSTT1 |
Rabbit Polyclonal Anti-GPX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI |
Rabbit Polyclonal Anti-GSTT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTT1 antibody: synthetic peptide directed towards the C terminal of human GSTT1. Synthetic peptide located within the following region: TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR |
Rabbit anti-ANPEP Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANPEP |
GGT1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GGT1 |
USD 424.00
5 Days
Mouse Monoclonal Glucose 6 Phosphate Dehydrogenase Antibody (2H7) Cytosol Marker
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TA336922 is a replacement of AM06697SU-N.
Rabbit polyclonal GCLM Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GCLM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-274 amino acids from the C-terminal region of human GCLM. |
Rabbit polyclonal antibody to glutathione transferase (glutathione S-transferase pi 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 63 of GSTP1 (Uniprot ID#P09211) |
Rabbit polyclonal anti-MGST3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MGST3. |
Rabbit polyclonal GSTO1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GSTO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 126-155 amino acids from the Central region of human GSTO1. |
Rabbit polyclonal GSTM1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GSTM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-211 amino acids from the C-terminal region of human GSTM1. |
Rabbit Polyclonal Anti-GCLM Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ |
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
Active filters
Reactivities
- Human
Applications
- IHC
Pathways
- Glutathione metabolism
Filter by
Category
Target Symbol
- GSTT2 (35)
- RRM1 (35)
- ANPEP (21)
- SMS (20)
- IDH1 (16)
- GSTP1 (14)
- RRM2 (11)
- GSS (10)
- GSTO2 (10)
- GSTA4 (6)
- PGD (6)
- GCLC (5)
- GGT1 (3)
- GSTO1 (3)
- GSTT1 (3)
- IDH2 (3)
- GCLM (2)
- GPX4 (2)
- GSR (2)
- GSTA2 (2)
- G6PD (1)
- GPX1 (1)
- GPX2 (1)
- GPX3 (1)
- GPX7 (1)
- GSTA1 (1)
- GSTA3 (1)
- GSTM1 (1)
- GSTM2 (1)
- MGST1 (1)
- MGST2 (1)
- MGST3 (1)
- ODC1 (1)
- RRM2B (1)