Antibodies

Jump to Filters
View as table Download
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA326810

USD 275.00

3 Weeks

PPARG Rabbit Polyclonal Antibody

Applications ICC/IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen N term -peptide of human PPARG
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA331938

USD 310.00

5 Days

Rabbit Polyclonal Anti-PPARG Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPARG Antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA336911

USD 424.00

5 Days

Rabbit Polyclonal PPAR gamma/NR1C3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human PPAR gamma protein (between residues 20-120) [UniProt P37231]
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA321842

USD 345.00

4 Weeks

Anti-PPARG Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human peroxisome proliferator-activated receptor gamma
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA321843

USD 345.00

In Stock

Anti-PPARG Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human peroxisome proliferator-activated receptor gamma