Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ATG16L Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ATG16L antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 161-190 amino acids from human ATG16L. |
Rabbit Polyclonal Anti-ATG16L1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG16L1 Antibody: synthetic peptide directed towards the N terminal of human ATG16L1. Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ |
ATG16L1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATG16L1 (NP_110430.5). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
ATG16L1 mouse monoclonal antibody,clone OTI5A2
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- ATG16L1
Reactivities
- Human
Applications
- IHC