TSG101 (201-281) mouse monoclonal antibody, clone 5B7, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
TSG101 (201-281) mouse monoclonal antibody, clone 5B7, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
TSG101 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-TSG101 Antibody
Applications | IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TSG101 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS |
TSG101 rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TSG101 |
TSG101 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TSG101 |
TSG101/VPS23 Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human TSG101/VPS23 (NP_006283.1). |
Modifications | Unmodified |
TSG101 Rabbit polyclonal Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TSG101. AA range:281-330 |
TSG101 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human TSG101 |
TSG101 Rabbit monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |