Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
USD 515.00
In Stock
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Rabbit polyclonal anti-MMP-1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-1 antibody. |
Rabbit polyclonal CTSA / PPGB (32k, Cleaved-Arg326) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PPGB |
F12 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F12 |
Goat Anti-TMPRSS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DSTRCNADDAYQGE, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1. |
Rabbit polyclonal anti-MASP2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MASP2. |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal FLIP Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FLIP antibody was raised against a peptide corresponding to amino acids near the C-terminus of human FLIPaFLIPl form. The immunogen is located within the last 50 amino acids of FLIP. |
Rabbit polyclonal antibody to MALT1 (mucosa associated lymphoid tissue lymphoma translocation gene 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 341 and 609 of MALT1 (Uniprot ID#Q9UDY8) |
Rabbit Polyclonal FLIP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | FLIP antibody was raised against a 19 amino acid peptide near the carboxy terminus of human FLIP. The immunogen is located within amino acids 180 - 230 of FLIP. |
USD 415.00
In Stock
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125 |
| Modifications | Phospho-specific |
Rabbit monoclonal antibody against PSMA (EP3253 )
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Protease
Availabilities
- In Stock
Filter by
Target Symbol
- CASP3 (7)
- CFLAR (7)
- CASP7 (6)
- CTSD (6)
- CASP9 (5)
- F10 (5)
- CASP2 (4)
- CASP8 (4)
- ACE (3)
- ACR (3)
- ADAM17 (3)
- CASP1 (3)
- CASP6 (3)
- MME (3)
- MMP1 (3)
- MMP11 (3)
- MMP2 (3)
- PARK7 (3)
- SENP1 (3)
- UCHL1 (3)
- ACY1 (2)
- ADAM32 (2)
- ADAMTS18 (2)
- AGA (2)
- ATG4B (2)
- ATG4C (2)
- BACE1 (2)
- C1R (2)
- C1S (2)
- CAPN1 (2)
- CAPN2 (2)
- CAPNS1 (2)
- CASP5 (2)
- COPS5 (2)
- CTSA (2)
- CTSE (2)
- CTSL (2)
- CTSV (2)
- CTSZ (2)
- ENPEP (2)
- ERAP1 (2)
- F12 (2)
- F2 (2)
- KLKB1 (2)
- MALT1 (2)
- MMP12 (2)
- MMP15 (2)
- MMP23B (2)
- PLG (2)
- PRCP (2)
- PRSS50 (2)
- PSEN1 (2)
- PSMD14 (2)
- SENP5 (2)
- TPP1 (2)
- UQCRC1 (2)
- ADAM15 (1)
- ADAM2 (1)
- ADAM20 (1)
- ADAMTS16 (1)
- ANPEP (1)
- APEH (1)
- ATG4A (1)
- BACE2 (1)
- CAPN7 (1)
- CASP10 (1)
- CASP4 (1)
- CNDP1 (1)
- CPA2 (1)
- CPE (1)
- CPM (1)
- CPN1 (1)
- CTRL (1)
- CTSC (1)
- CTSG (1)
- CTSH (1)
- DHH (1)
- ECE1 (1)
- F7 (1)
- FOLH1 (1)
- FURIN (1)
- GGH (1)
- GGT1 (1)
- GGT7 (1)
- GNL3L (1)
- GZMH (1)
- GZMK (1)
- HP (1)
- HPR (1)
- IDE (1)
- KLK11 (1)
- KLK14 (1)
- KLK15 (1)
- KLK5 (1)
- KLK6 (1)
- LONP1 (1)
- LTA4H (1)
- LTF (1)
- MASP1 (1)
- MASP2 (1)
Reactivities
Antibody Hosts
Clonalities
Modifications
Pathways
- Alzheimer's disease (41)
- Apoptosis (37)
- Pathways in cancer (23)
- Lysosome (22)
- Parkinson's disease (21)
- Complement and coagulation cascades (20)
- Huntington's disease (19)
- Viral myocarditis (16)
- p53 signaling pathway (16)
- Amyotrophic lateral sclerosis (ALS) (15)
- Colorectal cancer (12)
- Renin-angiotensin system (12)
- Epithelial cell signaling in Helicobacter pylori infection (10)
- Metabolic pathways (10)
- NOD-like receptor signaling pathway (9)
- Bladder cancer (7)
- MAPK signaling pathway (7)
- Natural killer cell mediated cytotoxicity (7)
- Endometrial cancer (5)
- Hematopoietic cell lineage (5)
- Neuroactive ligand-receptor interaction (5)
- Non-small cell lung cancer (5)
- Notch signaling pathway (5)
- Pancreatic cancer (5)
- Prostate cancer (5)
- RIG-I-like receptor signaling pathway (5)
- Regulation of autophagy (5)
- Small cell lung cancer (5)
- Systemic lupus erythematosus (5)
- VEGF signaling pathway (5)
- GnRH signaling pathway (4)
- Leukocyte transendothelial migration (4)
- Proteasome (4)
- Toll-like receptor signaling pathway (4)
- Arachidonic acid metabolism (3)
- Cardiac muscle contraction (3)
- Cytosolic DNA-sensing pathway (3)
- Glutathione metabolism (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Oxidative phosphorylation (3)
- PPAR signaling pathway (3)
- Wnt signaling pathway (3)
- Antigen processing and presentation (2)
- Arginine and proline metabolism (2)
- B cell receptor signaling pathway (2)
- Cyanoamino acid metabolism (2)
- Focal adhesion (2)
- Neurotrophin signaling pathway (2)
- Other glycan degradation (2)
- Regulation of actin cytoskeleton (2)
- Selenoamino acid metabolism (2)
- T cell receptor signaling pathway (2)
- Taurine and hypotaurine metabolism (2)
- Endocytosis (1)
- Folate biosynthesis (1)
- Hedgehog signaling pathway (1)
- Histidine metabolism (1)
- Spliceosome (1)
- Type I diabetes mellitus (1)
- beta-Alanine metabolism (1)