Germany
Japan
United Kingdom
China
Antibodies
Download
USD 428.00
In Stock
USD 180.00
In Stock
DDK Rabbit monoclonal antibody,clone OTIR5G2, recognizes both N-terminal and C-terminal DDK tags
| Applications | ELISA, IP, WB |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
USD 428.00
In Stock
Rabbit Monoclonal Anti-Human IgG4 Antibody, Clone RM120
| Applications | ELISA: 50ng/well - 200ng/well for Capture;, 0.05ug/mL - 0.2ug/mL for Detection;, , WB: 0.5 ug/mL - 2 ug/mL;, ICC: 1 ug/mL-10ug/mL;, IHC: 1 ug/mL-10ug/mL |
| Reactivities | Human IgG4 |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-HA tag Antibody, clone OTIR5B11
| Applications | WB |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-HA tag Antibody, clone OTIR7C9
| Applications | WB |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-ST13 Antibody, clone OTIR191G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-HIF1a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli. |
Active filters
Applications
- WB
Isotypes
- IgG
Conjugates
- Unconjugated
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (18)
- MAPT (18)
- AKT1 (16)
- TP53 (15)
- JUN (14)
- EZR (13)
- NR3C1 (12)
- CHEK1 (11)
- RELA (11)
- ATF2 (10)
- GRIN2B (10)
- MET (10)
- PRKCD (10)
- SRC (10)
- EIF4EBP1 (9)
- ERBB2 (9)
- MAPK14 (9)
- PAK1 (9)
- PDGFRB (9)
- RPS6KB1 (9)
- BRAF (8)
- CHUK (8)
- CREB1 (8)
- CSF1R (8)
- CTNNB1 (8)
- FGFR1 (8)
- FOXO1 (8)
- IKBKG (8)
- IRS1 (8)
- NFKB1 (8)
- NOS3 (8)
- PRKCA (8)
- PTK2 (8)
- PTPN11 (8)
- RAF1 (8)
- RUNX1 (8)
- STAT5A (8)
- YWHAZ (8)
- CASP3 (7)
- CCNB1 (7)
- CDC25A (7)
- CDK2 (7)
- CFLAR (7)
- ESR1 (7)
- MAP2K1 (7)
- MAP2K4 (7)
- MAPK3 (7)
- PPP1R1B (7)
- PXN (7)
- RPS6KA5 (7)
- SNCA (7)
- SOX2 (7)
- STAT1 (7)
- ABL1 (6)
- AFP (6)
- BAD (6)
- BCL2L1 (6)
- CASP7 (6)
- CTSD (6)
- DPYSL2 (6)
- ELK1 (6)
- EPHA2 (6)
- GAB2 (6)
- GAPDH (6)
- GJA1 (6)
- GSK3A (6)
- HDAC1 (6)
- IGF1R (6)
- JAK2 (6)
- LMNA (6)
- MDM2 (6)
- NFKBIA (6)
- NGFR (6)
- RAB27A (6)
- RB1 (6)
- SARS-COV-2 SPIKE PROTEIN (6)
- SHC1 (6)
- SMAD1 (6)
- SMAD3 (6)
- STAT3 (6)
- SYK (6)
- TH (6)
- ACTB (5)
- AGT (5)
- AKR1B1 (5)
- APP (5)
- ARF6 (5)
- BAX (5)
- BLNK (5)
- BRCA1 (5)
- CAMK2A (5)
- CASP9 (5)
- CAV1 (5)
- CCNE1 (5)
- CD19 (5)
- CDC25B (5)
- CDK1 (5)
- CDKN1A (5)
- CEBPA (5)
- CHEK2 (5)
Reactivities
- Human (6407)
- Mouse (4822)
- Rat (3725)
- Monkey (146)
- Dog (120)
- Canine (112)
- Bovine (58)
- Cow (57)
- Pig (55)
- Chicken (32)
- Rhesus Monkey (18)
- Zebrafish (18)
- Chimpanzee (15)
- Xenopus (14)
- X. tropicalis (13)
- SARS-CoV-2 (11)
- Rabbit (8)
- Sheep (7)
- Porcine (4)
- Feline (3)
- Primate (3)
- Guinea Pig (2)
- Hamster (2)
- N-term and C-term DDK (2)
- Drosophila (1)
- Drosophila melanogaster (1)
- Equine (1)
- Ferret (1)
- Fish (1)
- Horse (1)
- Murine (1)
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (4119)
- Transmembrane (1520)
- Transcription Factors (995)
- Protein Kinase (671)
- Secreted Protein (503)
- ES Cell Differentiation/IPS (454)
- Stem cell - Pluripotency (299)
- Protease (241)
- GPCR (185)
- Adult stem cells (97)
- Phosphatase (88)
- Stem cell relevant signaling - JAK/STAT signaling pathway (77)
- Embryonic stem cells (72)
- Cancer stem cells (65)
- Nuclear Hormone Receptor (62)
- Induced pluripotent stem cells (48)
- Ion Channels: Other (44)
- P450 (43)
- Stem cell relevant signaling - DSL/Notch pathway (36)
- Ion Channels: Potassium (34)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (29)
- Ion Channels: Glutamate Receptors (21)
- Ion Channels: Cys-loop Receptors (14)
- Stem cell relevant signaling - Wnt Signaling pathway (13)
- Ion Channels: Transient receptor potential (8)
- Ion Channels: Sodium (3)
- Ion Channels: ATP Receptors (1)
- Ion Channels: Calcium (1)
- Ion Channels: Cyclic nucleotide gated (1)
Pathways
- Pathways in cancer (654)
- Metabolic pathways (470)
- MAPK signaling pathway (458)
- Focal adhesion (374)
- Neurotrophin signaling pathway (329)
- Prostate cancer (294)
- Regulation of actin cytoskeleton (292)
- ErbB signaling pathway (290)
- Chemokine signaling pathway (275)
- Chronic myeloid leukemia (257)
- Insulin signaling pathway (246)
- T cell receptor signaling pathway (237)
- Cell cycle (231)
- Colorectal cancer (231)
- Pancreatic cancer (228)
- Cytokine-cytokine receptor interaction (209)
- Small cell lung cancer (200)
- Leukocyte transendothelial migration (198)
- Alzheimer's disease (197)
- Apoptosis (197)
- Toll-like receptor signaling pathway (195)
- Acute myeloid leukemia (194)
- Glioma (193)
- Endocytosis (192)
- Fc gamma R-mediated phagocytosis (192)
- Wnt signaling pathway (190)
- Melanoma (187)
- B cell receptor signaling pathway (186)
- GnRH signaling pathway (186)
- Neuroactive ligand-receptor interaction (182)
- Calcium signaling pathway (175)
- Epithelial cell signaling in Helicobacter pylori infection (175)
- Adherens junction (174)
- Non-small cell lung cancer (173)
- VEGF signaling pathway (172)
- Natural killer cell mediated cytotoxicity (171)
- Progesterone-mediated oocyte maturation (171)
- Jak-STAT signaling pathway (170)
- Fc epsilon RI signaling pathway (164)
- Endometrial cancer (163)
- Adipocytokine signaling pathway (161)
- Huntington's disease (161)
- Renal cell carcinoma (156)
- Tight junction (154)
- Axon guidance (153)
- Oocyte meiosis (151)
- Bladder cancer (141)
- p53 signaling pathway (140)
- Gap junction (135)
- Melanogenesis (131)
- Vascular smooth muscle contraction (130)
- Amyotrophic lateral sclerosis (ALS) (127)
- NOD-like receptor signaling pathway (122)
- Long-term potentiation (117)
- Pathogenic Escherichia coli infection (113)
- RIG-I-like receptor signaling pathway (113)
- mTOR signaling pathway (111)
- Olfactory transduction (99)
- Parkinson's disease (94)
- Long-term depression (92)
- Ubiquitin mediated proteolysis (92)
- Cell adhesion molecules (CAMs) (88)
- TGF-beta signaling pathway (88)
- Type II diabetes mellitus (85)
- Hematopoietic cell lineage (78)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (75)
- Thyroid cancer (74)
- Cytosolic DNA-sensing pathway (73)
- Hypertrophic cardiomyopathy (HCM) (72)
- Dilated cardiomyopathy (68)
- Viral myocarditis (67)
- Glycolysis / Gluconeogenesis (57)
- Prion diseases (56)
- Basal cell carcinoma (55)
- Purine metabolism (54)
- Systemic lupus erythematosus (53)
- Vibrio cholerae infection (53)
- PPAR signaling pathway (51)
- Dorso-ventral axis formation (49)
- Oxidative phosphorylation (49)
- Antigen processing and presentation (48)
- Complement and coagulation cascades (48)
- Phosphatidylinositol signaling system (46)
- Lysosome (44)
- Arginine and proline metabolism (43)
- ECM-receptor interaction (43)
- Notch signaling pathway (42)
- Primary immunodeficiency (42)
- Cardiac muscle contraction (35)
- Drug metabolism - cytochrome P450 (35)
- Pyruvate metabolism (35)
- Ribosome (34)
- ABC transporters (33)
- Glycerolipid metabolism (33)
- Spliceosome (32)
- Metabolism of xenobiotics by cytochrome P450 (31)
- Hedgehog signaling pathway (30)
- Pyrimidine metabolism (30)
- Fructose and mannose metabolism (29)
- Arachidonic acid metabolism (28)
- Base excision repair (28)
- Inositol phosphate metabolism (28)
- Nucleotide excision repair (28)
- Tyrosine metabolism (28)
- Tryptophan metabolism (27)
- DNA replication (26)
- Valine (26)
- Butanoate metabolism (25)
- Retinol metabolism (25)
- SNARE interactions in vesicular transport (25)
- leucine and isoleucine degradation (24)
- Alanine (23)
- aspartate and glutamate metabolism (23)
- Histidine metabolism (22)
- Regulation of autophagy (22)
- Fatty acid metabolism (21)
- Homologous recombination (21)
- Mismatch repair (21)
- Nitrogen metabolism (21)
- Proteasome (21)
- Type I diabetes mellitus (21)
- Androgen and estrogen metabolism (20)
- Renin-angiotensin system (20)
- Citrate cycle (TCA cycle) (19)
- Glutathione metabolism (19)
- Pentose phosphate pathway (18)
- Propanoate metabolism (18)
- Taste transduction (18)
- Lysine degradation (17)
- Cysteine and methionine metabolism (16)
- Drug metabolism - other enzymes (16)
- Galactose metabolism (16)
- Glycerophospholipid metabolism (16)
- Maturity onset diabetes of the young (16)
- Starch and sucrose metabolism (16)
- Amino sugar and nucleotide sugar metabolism (15)
- Basal transcription factors (15)
- Primary bile acid biosynthesis (15)
- RNA degradation (15)
- beta-Alanine metabolism (15)
- Autoimmune thyroid disease (14)
- Graft-versus-host disease (14)
- Linoleic acid metabolism (14)
- Allograft rejection (13)
- Biosynthesis of unsaturated fatty acids (12)
- Limonene and pinene degradation (12)
- Non-homologous end-joining (12)
- Phenylalanine metabolism (12)
- Asthma (11)
- Sphingolipid metabolism (11)
- Ascorbate and aldarate metabolism (10)
- Glycine (10)
- serine and threonine metabolism (10)
- Aminoacyl-tRNA biosynthesis (9)
- C21-Steroid hormone metabolism (9)
- Ether lipid metabolism (9)
- N-Glycan biosynthesis (9)
- Pentose and glucuronate interconversions (9)
- Taurine and hypotaurine metabolism (9)
- Folate biosynthesis (8)
- Nicotinate and nicotinamide metabolism (7)
- One carbon pool by folate (7)
- Selenoamino acid metabolism (7)
- Terpenoid backbone biosynthesis (7)
- Fatty acid biosynthesis (6)
- Glycosaminoglycan degradation (6)
- Other glycan degradation (6)
- Porphyrin and chlorophyll metabolism (6)
- RNA polymerase (6)
- Riboflavin metabolism (6)
- Caffeine metabolism (5)
- Glyoxylate and dicarboxylate metabolism (5)
- Methane metabolism (5)
- alpha-Linolenic acid metabolism (5)
- Circadian rhythm - mammal (4)
- Glycosphingolipid biosynthesis - ganglio series (4)
- Lysine biosynthesis (4)
- Phenylalanine (4)
- Steroid biosynthesis (4)
- Synthesis and degradation of ketone bodies (4)
- leucine and isoleucine biosynthesis (4)
- tyrosine and tryptophan biosynthesis (4)
- Chondroitin sulfate biosynthesis (3)
- Cyanoamino acid metabolism (3)
- Fatty acid elongation in mitochondria (3)
- Heparan sulfate biosynthesis (3)
- Keratan sulfate biosynthesis (3)
- O-Glycan biosynthesis (3)
- Pantothenate and CoA biosynthesis (3)
- Vitamin B6 metabolism (3)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Protein export (2)
- Sulfur metabolism (2)
- D-Glutamine and D-glutamate metabolism (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- O-Mannosyl glycan biosynthesis (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)