Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Goat Anti-APOL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NNNYKILQADQE, from the C Terminus of the protein sequence according to NP_003652.2; NP_663318.1. |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit polyclonal antibody to QSOX1 (quiescin Q6 sulfhydryl oxidase 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 231 and 617 of QSOX1 (Uniprot ID#O00391) |
Rabbit Polyclonal Anti-ITLN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITLN1 antibody: synthetic peptide directed towards the middle region of human ITLN1. Synthetic peptide located within the following region: WTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANA |
Goat Polyclonal Antibody against APOE
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-VGTSAAPVPSDNH, from the C Terminus of the protein sequence according to NP_000032.1. |
Rabbit polyclonal anti-MMP-1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-1 antibody. |
Rabbit anti-LIPC Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LIPC |
Rabbit anti-KNG1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KNG1 |
F12 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F12 |
Rabbit Polyclonal Anti-TNFSF14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF14 antibody: synthetic peptide directed towards the middle region of human TNFSF14. Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM |
Rabbit polyclonal Anti-TREM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TREM2 antibody: synthetic peptide directed towards the middle region of human TREM2. Synthetic peptide located within the following region: FPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASA |
Goat Polyclonal Antibody against ARMET
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KFCREARGKENR, from the internal region of the protein sequence according to NP_006001.2. |
Goat Polyclonal Antibody against FGF23
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RHTRSAEDDSERD, from the internal region of the protein sequence according to NP_065689.1. |
Rabbit Polyclonal antibody to C1 inhibitor (serpin peptidase inhibitor, clade G (C1 inhibitor), member 1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 77 and 420 of C1 inhibitor (Uniprot ID#P05155) |
Rabbit Anti-Periostin C-terminal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Bacterial fusion protein equivalent to a 188-amino acid polypeptide from the C-terminal region of mouse periostin which is comprised of six small alternatively-spliced exons |
USD 432.00
In Stock
Active filters
Applications
- WB
Isotypes
- IgG
Families
- Secreted Protein
Availabilities
- In Stock
Filter by
Category
Target Symbol
- EGFR (18)
- AFP (6)
- AGT (5)
- HSD17B13 (5)
- MUC1 (5)
- STX1A (5)
- SYT1 (5)
- DKK3 (4)
- ERBB3 (4)
- IGFBP3 (4)
- LGALS3 (4)
- LOX (4)
- SPP1 (4)
- ACE (3)
- AMPH (3)
- ANXA2 (3)
- APOH (3)
- APOL1 (3)
- CSF2RA (3)
- EPHA3 (3)
- FGB (3)
- GDF15 (3)
- GNAS (3)
- IL18BP (3)
- MMP1 (3)
- NRG1 (3)
- SERPINB5 (3)
- TIMP4 (3)
- TTR (3)
- VEGFB (3)
- A1BG (2)
- ACP6 (2)
- ADAMTS18 (2)
- ADGRE5 (2)
- ADIPOQ (2)
- ADM (2)
- ANGPT1 (2)
- APOE (2)
- ARSF (2)
- ARTN (2)
- B2M (2)
- BDNF (2)
- BMP3 (2)
- CBLN1 (2)
- CCL17 (2)
- CHGB (2)
- CLU (2)
- CRP (2)
- CSF2 (2)
- EDA (2)
- EPOR (2)
- ERAP1 (2)
- F12 (2)
- F2 (2)
- FAS (2)
- FASLG (2)
- FSTL1 (2)
- GDF7 (2)
- IL1RN (2)
- IL20 (2)
- IL3 (2)
- IL4R (2)
- INS (2)
- ITLN1 (2)
- KLK8 (2)
- KNG1 (2)
- LAMB1 (2)
- MMP23B (2)
- MSMB (2)
- ORM1 (2)
- PCSK9 (2)
- PLG (2)
- PON1 (2)
- SCG3 (2)
- SELENOP (2)
- SERPINA5 (2)
- SERPINB4 (2)
- SERPING1 (2)
- TF (2)
- TIMP3 (2)
- TNFRSF11B (2)
- TNFSF13 (2)
- TNFSF14 (2)
- TREM2 (2)
- VASH1 (2)
- VEGFA (2)
- VEGFC (2)
- VGF (2)
- WNT10A (2)
- ACRBP (1)
- ADCK1 (1)
- AGR2 (1)
- AGR3 (1)
- AHSG (1)
- ALB (1)
- AMBP (1)
- AMY2A (1)
- ANGPT4 (1)
- ANGPTL2 (1)
- AOC1 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Cytokine-cytokine receptor interaction (92)
- Pathways in cancer (63)
- MAPK signaling pathway (43)
- Focal adhesion (37)
- Regulation of actin cytoskeleton (33)
- Jak-STAT signaling pathway (32)
- Bladder cancer (29)
- Melanoma (28)
- Pancreatic cancer (28)
- Endocytosis (26)
- Calcium signaling pathway (25)
- ErbB signaling pathway (25)
- GnRH signaling pathway (23)
- Complement and coagulation cascades (22)
- Hematopoietic cell lineage (22)
- Gap junction (21)
- Prostate cancer (21)
- Colorectal cancer (20)
- Epithelial cell signaling in Helicobacter pylori infection (19)
- Adherens junction (18)
- Dorso-ventral axis formation (18)
- Endometrial cancer (18)
- Glioma (18)
- Non-small cell lung cancer (18)
- TGF-beta signaling pathway (16)
- Type I diabetes mellitus (12)
- Apoptosis (11)
- Autoimmune thyroid disease (11)
- Hedgehog signaling pathway (11)
- Melanogenesis (11)
- Wnt signaling pathway (11)
- p53 signaling pathway (11)
- Allograft rejection (10)
- ECM-receptor interaction (10)
- Metabolic pathways (10)
- Natural killer cell mediated cytotoxicity (10)
- Renal cell carcinoma (10)
- Toll-like receptor signaling pathway (10)
- mTOR signaling pathway (10)
- Basal cell carcinoma (9)
- Graft-versus-host disease (9)
- Neuroactive ligand-receptor interaction (9)
- Renin-angiotensin system (9)
- Alzheimer's disease (8)
- T cell receptor signaling pathway (8)
- Adipocytokine signaling pathway (7)
- Asthma (7)
- Fc epsilon RI signaling pathway (7)
- PPAR signaling pathway (7)
- Antigen processing and presentation (6)
- Chemokine signaling pathway (6)
- Dilated cardiomyopathy (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- Neurotrophin signaling pathway (6)
- SNARE interactions in vesicular transport (6)
- Regulation of autophagy (5)
- Systemic lupus erythematosus (5)
- Type II diabetes mellitus (5)
- Axon guidance (4)
- Long-term depression (4)
- Small cell lung cancer (4)
- Amyotrophic lateral sclerosis (ALS) (3)
- Cell cycle (3)
- Cytosolic DNA-sensing pathway (3)
- Fc gamma R-mediated phagocytosis (3)
- Maturity onset diabetes of the young (3)
- NOD-like receptor signaling pathway (3)
- Prion diseases (3)
- RIG-I-like receptor signaling pathway (3)
- Taste transduction (3)
- Vascular smooth muscle contraction (3)
- Vibrio cholerae infection (3)
- Cell adhesion molecules (CAMs) (2)
- Chronic myeloid leukemia (2)
- Glycerolipid metabolism (2)
- Glycosaminoglycan degradation (2)
- Histidine metabolism (2)
- Huntington's disease (2)
- Insulin signaling pathway (2)
- Oocyte meiosis (2)
- Primary immunodeficiency (2)
- Progesterone-mediated oocyte maturation (2)
- Riboflavin metabolism (2)
- VEGF signaling pathway (2)
- Acute myeloid leukemia (1)
- Arginine and proline metabolism (1)
- Folate biosynthesis (1)
- N-Glycan biosynthesis (1)
- Nitrogen metabolism (1)
- Pathogenic Escherichia coli infection (1)
- Proteasome (1)
- Starch and sucrose metabolism (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- Viral myocarditis (1)
- beta-Alanine metabolism (1)