Rabbit anti-RPA2 Polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPA2 |
Rabbit anti-RPA2 Polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPA2 |
Rabbit anti-MRE11A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MRE11A |
Rabbit anti-POLD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLD1 |
Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694) |
Rabbit Polyclonal Anti-RAD51 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS |
Rabbit Polyclonal MRE11 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MRE11 antibody was raised against a 14 amino acid peptide from near the amino terminus human MRE11. |
Rabbit polyclonal anti-RAD54 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD54. |
Mouse Monoclonal RPA70 Antibody
Applications | IF, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MRE11A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MRE11A Antibody: A synthesized peptide derived from human MRE11A |
Rabbit Polyclonal Antibody against Mre11
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length human Mre11 protein |
Rabbit polyclonal RFA2 (Ab-21) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
Rabbit Polyclonal RFA2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human RFA2 |
Rabbit Polyclonal RFA2 (Thr21) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human RFA2 around the phosphorylation site of Threonine 21 |
Modifications | Phospho-specific |
Rabbit polyclonal anti-POLD1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD1. |
Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
Modifications | Phospho-specific |
Rabbit polyclonal RAD51 (Ab-315) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAD51 around the phosphorylation site of tyrosine 315 (K-I-YP-D-S). |
Anti-RPA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human replication protein A1, 70kDa |
Rabbit polyclonal RFA2 (Ser33) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of serine 33 (A-P-SP-Q-A). |
Modifications | Phospho-specific |
Rabbit polyclonal RAD51 (Tyr315) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RAD51 around the phosphorylation site of tyrosine 315 (K-I-YP-D-S). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-Mre11 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corres-ponding to amino acids 68-706 of mouse Mre11 protein. |
Goat Polyclonal RPA1/RPA70 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CKSYEDATKITVRSN (aa323-337), from the internal region of the protein sequence according to NP_002936.1 |
Rabbit polyclonal POLD2 Antibody (Center)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2. |
Mouse Monoclonal Rad51 Antibody
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7F4 (formerly 7F4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MRE11A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MRE11A |
Rabbit Polyclonal Anti-RAD51 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RAD51 |
RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-RPA2 mouse monoclonal antibody, clone OTI7F4 (formerly 7F4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-RPA2 mouse monoclonal antibody, clone OTI7F4 (formerly 7F4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-RAD51 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RAD51 |