Antibodies

Jump to Filters
View as table Download
CD63
AB0047-200

USD 320.00

In Stock

Goat Polyclonal Anti-CD63 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli.
LAMP1 Rabbit Polyclonal Antibody
TA332567

USD 275.00

3 Weeks

Rabbit anti-LAMP1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LAMP1
CD63
AB0047-500

USD 450.00

In Stock

Goat Polyclonal Anti-CD63 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli.
Niemann Pick C1 (NPC1) Rabbit Polyclonal Antibody
TA336646

USD 457.00

5 Days

Rabbit Polyclonal Niemann-Pick C1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine, Hamster, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118]
LAMP1 Rabbit Polyclonal Antibody
TA306262

USD 430.00

In Stock

Rabbit Polyclonal LAMP-1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LAMP-1 antibody was raised against a 15 amino acid peptide from near the center of human LAMP-1.
LAMP2 Rabbit Polyclonal Antibody
TA319001

USD 365.00

3 Weeks

Rabbit polyclonal anti-LAMP2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 403 of rat LAMP2
ATP6AP1 Rabbit Polyclonal Antibody
TA326997

USD 275.00

3 Weeks

Rabbit anti-ATP6AP1 Polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ATP6AP1
beta glucuronidase (GUSB) Rabbit Polyclonal Antibody
TA313989

USD 345.00

4 Weeks

Rabbit polyclonal anti-GUSB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GUSB.
LIMPII (SCARB2) Rabbit Polyclonal Antibody
TA306583

USD 430.00

5 Days

Rabbit Polyclonal LIMP2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LIMP2 antibody was raised against a 16 amino acid peptide from near the center of human LIMP2.
LIMPII (SCARB2) Rabbit Polyclonal Antibody
TA336643

USD 479.00

5 Days

Rabbit Polyclonal LIMPII/lpg85 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A C-terminal synthetic peptide made to the mouse LIMPII/lgp85 protein sequence. [UniProt# O35114]
Sortilin (SORT1) Rabbit Polyclonal Antibody
TA328904

USD 585.00

3 Weeks

Rabbit polyclonal Anti-Sortilin

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide DKDTTRRIHVSTDQD(C) corresponding to amino acid residues 320-335 of human Sortilin . Extracellular domain.
LIMPII (SCARB2) Rabbit Polyclonal Antibody
TA336640

USD 457.00

5 Days

Rabbit Polyclonal LIMPII/SR-B2 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Hamster
Conjugation Unconjugated
Immunogen A peptide containing residues from mouse SR-BII (between residues 400-478) plus an N-terminal cysteine was coupled to KLH. [UniProt# O35114]
TCIRG1 Rabbit Polyclonal Antibody
TA319811

USD 430.00

5 Days

Rabbit Polyclonal TCIRG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TCIRG1 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human TCIRG1.
ATP6AP1 Rabbit Polyclonal Antibody
TA321298

USD 345.00

4 Weeks

Anti-ATP6AP1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 90-390 amino acids of human ATPase, H+ transporting, lysosomal accessory protein 1
ATP6V0B Rabbit Polyclonal Antibody
TA335996

USD 375.00

5 Days

Rabbit Polyclonal Anti-Atp6v0b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Atp6v0b Antibody is: synthetic peptide directed towards the N-terminal region of Rat Atp6v0b. Synthetic peptide located within the following region: PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG
LAMP3 Rabbit Polyclonal Antibody
TA321832

USD 345.00

4 Weeks

Anti-LAMP3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-66 amino acids of Human lysosomal-associated membrane protein 3
ABCB9 Rabbit Polyclonal Antibody
TA322279

USD 345.00

In Stock

Anti-ABCB9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 9
Acid Phosphatase 2 (ACP2) Rabbit Polyclonal Antibody
TA350730

USD 345.00

In Stock

Rabbit Polyclonal Anti-ACP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACP2
DMT1 (SLC11A2) Rabbit Polyclonal Antibody
TA351143

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC11A2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC11A2
Sortilin (SORT1) Rabbit Polyclonal Antibody
TA351744

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-SORT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SORT1