Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Tyr341) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Raf1 around the phosphorylation site of tyrosine 341 (S-Y-YP-W-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal PLCG1 (Ab-771) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-Y-G-A). |
Rabbit polyclonal Akt (Thr450) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AKT1 around the phosphorylation site of threonine 450 (T-I-TP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Retinoblastoma (Ser608) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Retinoblastoma around the phosphorylation site of serine 608 (Y-L-SP-P-V). |
| Modifications | Phospho-specific |
Anti-RB1 (Phospho-Ser795) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 795 (P-S-S(p)-P-L) derived from Human Rb. |
| Modifications | Phospho-specific |
Rabbit polyclonal AKT2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 416-444 amino acids from the C-terminal region of human AKT2. |
Rabbit polyclonal ERBB2 Antibody(N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERBB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 21-52 amino acids from the N-terminal region of human ERBB2. |
Rabbit polyclonal CASP9 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9. |
Rabbit Polyclonal ERK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha/ gamma (Tyr467/199) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha/ gamma around the phosphorylation site of Tyrosine 467/199 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20 |
| Modifications | Phospho-specific |
Rabbit polyclonal B-RAF (Ab-446) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D). |
MEK2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | C term -peptide of human MEK2 |
FHIT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FHIT |
Rabbit anti-RASSF1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RASSF1 |
Rabbit Polyclonal Phospho-HER2 (Tyr1248) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HER2 around the phosphorylation site of Tyrosine 1248 |
| Modifications | Phospho-specific |
Rabbit Polyclonal HER2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HER2 |
Phospho-AKT1-S473 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S473 of human AKT1 |
| Modifications | Phospho-specific |
Phospho-AKT1-T308 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T308 of human AKT1 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RXRG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT |
Rabbit Polyclonal Anti-RASH/RASK/RASN Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RASH/RASK/RASN Antibody: A synthesized peptide derived from human RASH/RASK/RASN |
Rabbit Polyclonal Anti-Retinoic Acid Receptor beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Retinoic Acid Receptor beta Antibody: A synthesized peptide derived from human Retinoic Acid Receptor beta |
Rabbit Polyclonal Anti-TGF alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGF alpha Antibody: A synthesized peptide derived from human TGF alpha |
Rabbit Polyclonal Anti-EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
Rabbit Polyclonal Anti-AKT1/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKT1/3 Antibody: A synthesized peptide derived from human AKT1/3 |
Rabbit Polyclonal Anti-MAPK1/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPK1/3 Antibody: A synthesized peptide derived from human MAPK1/3 |
Rabbit Polyclonal Anti-AKT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKT1 Antibody: A synthesized peptide derived from human AKT1 |
Rabbit Polyclonal Anti-C-RAF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C-RAF Antibody: A synthesized peptide derived from human C-RAF |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-E2F-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F-1 Antibody: Peptide sequence around aa.430~434(G-D-L-T-P) derived from Human E2F-1 |
Rabbit Polyclonal Anti-E2F-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F-2 Antibody: Peptide sequence around aa.425~429(L-F-D-S-Y) derived from Human E2F-2. |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
Rabbit Polyclonal Anti-PI3-kinase p85-alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI3-kinase p85-alpha Antibody: A synthesized peptide derived from human PI3-kinase p85-alpha |
Rabbit Polyclonal Anti-Phospho-Retinoblastoma(Thr826) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-Retinoblastoma(Thr826) Antibody: A synthesized peptide derived from human Retinoblastoma around the phosphorylation site of Threonine 826 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Phospho-C-RAF(Ser301) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-C-RAF(Ser301) Antibody: A synthesized peptide derived from human C-RAF around the phosphorylation site of Sersine 301 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Phospho-AKT1(Thr308) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-AKT1(Thr308) Antibody: A synthesized peptide derived from human AKT1 around the phosphorylation site of Threonine 308 |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Applications
- WB
Clonalities
- Polyclonal
Pathways
- Non-small cell lung cancer
Filter by
Target Symbol
- AKT1 (42)
- EGFR (31)
- TP53 (16)
- ERBB2 (15)
- RAF1 (15)
- BRAF (14)
- MAP2K1 (13)
- MAPK1 (12)
- PRKCA (11)
- RB1 (11)
- BAD (10)
- CASP9 (10)
- AKT2 (9)
- MAPK3 (9)
- PLCG1 (9)
- PIK3R1 (8)
- PRKCB (8)
- PLCG2 (7)
- FOXO3 (6)
- MAP2K2 (6)
- CCND1 (5)
- CDK6 (5)
- CDKN2A (5)
- FHIT (5)
- GRB2 (5)
- NRAS (5)
- RARB (5)
- E2F1 (4)
- E2F2 (4)
- PDPK1 (4)
- PRKCG (4)
- RASSF1 (4)
- AKT3 (3)
- E2F3 (3)
- RXRB (3)
- RXRG (3)
- ARAF (2)
- EGF (2)
- HRAS (2)
- PIK3CA (2)
- RASSF5 (2)
- TGFA (2)
- CDK4 (1)
- KRAS (1)
- PIK3CB (1)
- PIK3CD (1)
- PIK3R2 (1)
- PIK3R3 (1)
- RXRA (1)
- SOS1 (1)
- SOS2 (1)
- STK4 (1)
Antibody Hosts
Conjugates
Modifications
Families
- Druggable Genome (345)
- Protein Kinase (205)
- ES Cell Differentiation/IPS (107)
- Transcription Factors (56)
- Transmembrane (50)
- Stem cell relevant signaling - JAK/STAT signaling pathway (36)
- Adult stem cells (33)
- Secreted Protein (33)
- Cancer stem cells (31)
- Stem cell - Pluripotency (31)
- Nuclear Hormone Receptor (12)
- Protease (10)
- Stem cell relevant signaling - DSL/Notch pathway (5)
- Stem cell relevant signaling - Wnt Signaling pathway (5)
- Embryonic stem cells (2)
- Induced pluripotent stem cells (2)