Antibodies

View as table Download

Rabbit Polyclonal Anti-KHK Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KHK antibody: synthetic peptide directed towards the C terminal of human KHK. Synthetic peptide located within the following region: FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV

Rabbit Polyclonal Anti-KHK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KHK antibody: synthetic peptide directed towards the N terminal of human KHK. Synthetic peptide located within the following region: FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI4E9 (formerly 4E9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KHK mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-KHK Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KHK

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4E9 (formerly 4E9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4E9 (formerly 4E9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated