Germany
Japan
United Kingdom
China
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Antibodies
View as table Download
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit Polyclonal Anti-CD8A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CD4 Antibody: Peptide with sequence C-KNKEVSVKRVTQDPK, from the internal region of the protein sequence according to NP_000607.1; NP_001181943.1. |
Mouse Monoclonal Anti-CD4 Antibody [9H5A8]
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD4 Antibody [8G1B12]
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CD8A (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Rabbit Polyclonal Anti-HSPA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the N terminal of human HSPA4. Synthetic peptide located within the following region: PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS |
Rabbit Polyclonal Anti-HSPA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the middle region of human HSPA4. Synthetic peptide located within the following region: PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK |
Mouse anti CD4(T4)-Hu Monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI9C1 (formerly 9C1)
| Applications | WB |
| Reactivities | Human, Monkey, Rat, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI9B7 (formerly 9B7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI3B1 (formerly 3B1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI4A9 (formerly 4A9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody,clone OTI5B7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody,clone OTI4D9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI4C6 (formerly 4C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI9G9 (formerly 9G9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Applications
- WB
Families
- ES Cell Differentiation/IPS
Pathways
- Antigen processing and presentation