Progesterone Receptor (PGR) mouse monoclonal antibody, Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Progesterone Receptor (PGR) mouse monoclonal antibody, Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Rabbit polyclonal antibody to Progesterone receptor (progesterone receptor)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 18 and 112 of Progesterone Receptor (Uniprot ID#P06401) |
Rabbit Polyclonal Progesterone Receptor Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor |
Rabbit Polyclonal Progesterone Receptor (Ser294) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 294 |
Modifications | Phospho-specific |
Rabbit Polyclonal Progesterone Receptor (Ser400) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 400 |
Modifications | Phospho-specific |
Progesterone Receptor (PGR) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 348-377 amino acids from the Central region of human Progesterone receptor |
Rabbit polyclonal PGR/PR Antibody (C-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PGR/PR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 816-843 amino acids from the C-terminal region of human PGR/PR. |
Rabbit anti Progesterone Receptor (PR) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to C-terminus of human Progesterone receptor. This sequence is identical within human, mouse, rat, chicken, bovine and dog origins. |
mouse Anti-Progesterone Receptor (Ser190) Antibody (Phospho-Specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
mouse Anti-Progesterone Receptor (Ser294) Antibody (Phospho-Specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-PR Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for Anti-PR antibody is: synthetic peptide directed towards the N-terminal region of Human PR. Synthetic peptide located within the following region: LPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAG |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody,clone OTI1B3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI11G9 (formerly 11G9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody,clone OTI1G7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI14G1 (formerly 14G1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI12D1 (formerly 12D1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI15C1 (formerly 15C1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI11E8 (formerly 11E8)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI5E8 (formerly 5E8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI6E3 (formerly 6E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI20A1 (formerly 20A1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI7A9 (formerly 7A9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI20A11 (formerly 20A11)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI7G7 (formerly 7G7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI24A2 (formerly 24A2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI18B12 (formerly 18B12)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI4C12 (formerly 4C12)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI16H2 (formerly 16H2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI29A3 (formerly 29A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI34G6 (formerly 34G6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI31D9 (formerly 31D9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI24D6 (formerly 24D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI26C2 (formerly 26C2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
PGR mouse monoclonal antibody,clone OTI1B3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
PGR mouse monoclonal antibody,clone 1B3, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
PGR mouse monoclonal antibody,clone 1B3, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
PGR mouse monoclonal antibody,clone OTI1B3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
PGR (Progesterone Receptor) mouse monoclonal antibody, clone OTI11G9 (formerly 11G9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
PGR mouse monoclonal antibody,clone 11G9, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
PGR mouse monoclonal antibody,clone 11G9, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
PGR (Progesterone Receptor) mouse monoclonal antibody, clone OTI11G9 (formerly 11G9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
PGR mouse monoclonal antibody,clone OTI1G7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |