NT5E Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NT5E |
NT5E Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NT5E |
Rabbit Polyclonal Anti-DHODH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHODH antibody: synthetic peptide directed towards the C terminal of human DHODH. Synthetic peptide located within the following region: GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS |
Rabbit Polyclonal p53R2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 . |
Rabbit Polyclonal Anti-DHODH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHODH antibody: synthetic peptide directed towards the N terminal of human DHODH. Synthetic peptide located within the following region: FGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLR |
Rabbit Polyclonal Anti-DHODH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHODH antibody: synthetic peptide directed towards the middle region of human DHODH. Synthetic peptide located within the following region: NLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL |
Rabbit Polyclonal Anti-DHODH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHODH antibody: synthetic peptide directed towards the N terminal of human DHODH. Synthetic peptide located within the following region: RFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLG |
Rabbit Polyclonal Anti-DHODH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHODH antibody: synthetic peptide directed towards the N terminal of human DHODH. Synthetic peptide located within the following region: GEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNS |
Rabbit Polyclonal Anti-DHODH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DHODH antibody is: synthetic peptide directed towards the N-terminal region of Human DHODH. Synthetic peptide located within the following region: RARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIG |
Rabbit Polyclonal Anti-NT5C3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C3 Antibody: A synthesized peptide derived from human NT5C3 |
CD73 (NT5E) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | NT5E antibody was raised against kLH conjugated synthetic peptide between 520-550 amino acids from the C-terminal region of human CD73 (NT5E). |
ENTPD3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 499-531 amino acids from the C-terminal region of Human ENTPD3. |
Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6 |
Rabbit Polyclonal T-cadherin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | T-cadherin antibody was raised against a 15 amino acid peptide from near the amino terminus of human T-cadherin. |
Rabbit polyclonal antibody to ENTPD5(CD39L4) (ectonucleoside triphosphate diphosphohydrolase 5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 191 of ENTPD5 (Uniprot ID#O75356) |
Rabbit polyclonal antibody to ENTPD3 (ectonucleoside triphosphate diphosphohydrolase 3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 200 and 459 of ENTPD3 (Uniprot ID#O75355) |
Rabbit polyclonal anti-RRM2B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RRM2B. |
Rabbit polyclonal RRM2B p53R2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-Human RRM2B/p53R2 antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human RRM2B1 protein. A residue of cysteine was added to facilitate coupling. |
Mouse monoclonal CD73(NT5E) Antibody (C-term)(Ascites)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD39 (ENTPD1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-NT5E antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NT5E. |
Rabbit Polyclonal Anti-NT5C3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII |
Rabbit Polyclonal Anti-ENTPD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENTPD6 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENTPD6. Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP |
Rabbit Polyclonal Anti-ENTPD8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENTPD8 Antibody: synthetic peptide directed towards the N terminal of human ENTPD8. Synthetic peptide located within the following region: IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG |
Rabbit Polyclonal Anti-ENTPD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ENTPD1 antibody: synthetic peptide directed towards the N terminal of human ENTPD1. Synthetic peptide located within the following region: AREVIPRSQHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPF |
Carrier-free (BSA/glycerol-free) Purified ENTPD1 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Purified ENTPD1 mouse monoclonal antibody, clone OTI9D10 (formerly 9D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENTPD1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENTPD1 mouse monoclonal antibody, clone OTI2A1 (formerly 2A1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENTPD1 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NT5E mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NT5E Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NT5E |
Rabbit Polyclonal Anti-ENTPD5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ENTPD5 |
Rabbit Polyclonal Anti-ENTPD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ENTPD1 |
ENTPD5 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
DCTN3 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NT5E Antibody - C-terminal region
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Purified ENTPD1 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified ENTPD1 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
Purified ENTPD1 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Purified ENTPD1 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Purified ENTPD1 mouse monoclonal antibody, clone OTI9D10 (formerly 9D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified ENTPD1 mouse monoclonal antibody, clone OTI9D10 (formerly 9D10), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
Purified ENTPD1 mouse monoclonal antibody, clone OTI9D10 (formerly 9D10), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Purified ENTPD1 mouse monoclonal antibody, clone OTI9D10 (formerly 9D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ENTPD1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ENTPD1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ENTPD1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ENTPD1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ENTPD1 mouse monoclonal antibody, clone OTI2A1 (formerly 2A1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ENTPD1 mouse monoclonal antibody, clone OTI2A1 (formerly 2A1), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |