Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259) |
Rabbit polyclonal GOT2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Rabbit polyclonal GLS Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS. |
Goat Polyclonal Antibody against Argininosuccinate synthetase 1
| Applications | WB |
| Reactivities | Human, Cow |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ENPKNQAPPGLYTKTQD, from the internal region of the protein sequence according to NP_000041.2 ; NP_446464.1. |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAD1 Antibody: A synthesized peptide derived from human GAD1 |
Rabbit Polyclonal Anti-GAD1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAD1/2 Antibody: A synthesized peptide derived from human GAD1/2 |
Rabbit Polyclonal antibody to Aspartoacylase (aspartoacylase (Canavan disease))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 300 of Aspartoacylase (Uniprot ID#P45381) |
Rabbit polyclonal GAD2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 109-138 amino acids from the Central region of human GAD2. |
Goat Polyclonal Antibody against GOT2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNLKKEGSTHNWQH, from the internal region of the protein sequence according to NP_002071.2. |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 465 and 558 of GAD65 (Uniprot ID#Q05329) |
Anti-GLUL Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.365~369(G-D-E-P-F) derived from Human Glutamine Synthetase |
Anti-AGXT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 280-294 amino acids of human alanine-glyoxylate aminotransferase |
Goat Polyclonal Antibody against GAD2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLEDNEERMSRLSK, from the internal region of the protein sequence according to NP_000809.1. |
Goat Polyclonal Antibody against GOT1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TADFREDPDPRKVN, from the internal region of the protein sequence according to NP_002070.1. |
Goat Polyclonal Antibody against GOT2 (Internal Region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CKDADEAKRVES, from the internal region of the protein sequence according to NP_002071.2. |
Goat Anti-GAD1 (isoform GAD67) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PDSPQRREKLHK, from the internal region of the protein sequence according to NP_000808.2. |
Rabbit Polyclonal Aldh5A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aldh5A1 antibody was raised against a 22 amino acid peptide near the carboxy terminus of the human Aldh5A1. |
Anti-GAD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 185 amino acids of human glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) |
Anti-GAD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.148~152 (E-L-A-D-Q) derived from Human GAD65 (GAD2). |
Rabbit polyclonal GPT Antibody (N-term R133)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This GPT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 118-144 amino acids from the N-terminal region of human GPT. |
Rabbit anti-GAD1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human GAD1 |
GOT2 Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region (QGYRYYDPKTCGFD) |
Rabbit Polyclonal Anti-ASNS Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR |
Anti-ACY3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-AGXT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 280-294 amino acids of human alanine-glyoxylate aminotransferase |
Anti-ALDH4A1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 4 family, member A1 |
Rabbit Polyclonal Anti-ASPA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASPA |
Rabbit Polyclonal Anti-ASNS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASNS |
USD 345.00
4 Weeks
Rabbit Polyclonal Anti-GOT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GOT2 |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAD1 |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAD1 |
Germany
Japan
United Kingdom
China
