Antibodies

View as table Download

Rabbit Polyclonal Anti-TRB3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRB3 antibody was raised against a 17 amino acid peptide near the center of human TRB3.

Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIB3 antibody: synthetic peptide directed towards the N terminal of human TRIB3. Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV

Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIB3 antibody is: synthetic peptide directed towards the N-terminal region of Human TRIB3. Synthetic peptide located within the following region: KNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPV

TRIB3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TRIB3 (NP_066981.2).
Modifications Unmodified

TRIB3 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human TRIB3