Goat Anti-ABCD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EDMQRKGYSEQD, from the internal region of the protein sequence according to NP_000024.2. |
Goat Anti-ABCD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EDMQRKGYSEQD, from the internal region of the protein sequence according to NP_000024.2. |
Goat Anti-ABCA9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QRVVQELEMENIQD, from the internal region of the protein sequence according to NP_525022.2. |
Goat Anti-MRP8 / ABCC11 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KVVEFDRPEVLRK, from the internal region (near C Terminus) of the protein sequence according to NP_115972.2; NP_660187.1. |
Rabbit Polyclonal ABCG8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide from the N-terminal region of human ABCG8 protein. |
Rabbit anti-ABCB8 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCB8. |
Rabbit anti-ABCD4 polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCD4. |
Rabbit anti-ABCB10 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCB10. |
Rabbit anti-ABCB5 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCB5 (910-940 amino acid region) |
Rabbit polyclonal anti-ABCC10 (MRP7) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MRP7. |
Rabbit Polyclonal ABCA7 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ABCA7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human ABCA7. |
Anti-ABCC5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human ATP-binding cassette, sub-family C? |
Anti-ABCG2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Rabbit Polyclonal Anti-ABCB9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCB9 Antibody: synthetic peptide directed towards the N terminal of human ABCB9. Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW |
Rabbit Polyclonal Anti-ABCA5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCA5 Antibody: synthetic peptide directed towards the C terminal of human ABCA5. Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI |
Rabbit Polyclonal Anti-ABCC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC3 Antibody: synthetic peptide directed towards the middle region of human ABCC3. Synthetic peptide located within the following region: KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL |
Rabbit Polyclonal Anti-ABCD3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCD3 Antibody: synthetic peptide directed towards the N terminal of human ABCD3. Synthetic peptide located within the following region: LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD |
ABCD2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 276~306 amino acids from the Central region of human ABCD2. |
ABCG4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 43-73 amino acids from the N-terminal region of human ABCG4 |
Goat Anti-ABCD3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PDGREDQKRKGISD, from the internal region of the protein sequence according to NP_002849.1. |
Rabbit anti-ABCA1 polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCA1. |
Rabbit anti-ABCA6 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCA6. |
Rabbit anti-ABCB9 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from human ABCB9. |
Goat Anti-TAP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QKFREKLQEIKT, from the internal region of the protein sequence according to NP_000584.2. |
Goat Anti-ABCD2 (aa460-473) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PLSDTLAIKGKVID, from the internal region of the protein sequence according to NP_005155.1. |
Rabbit polyclonal anti-ABCB6 antibody
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 440-455 of human ABCB6 protein. |
Anti-ABCA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.2253~2257(D-E-K-V-K) derived from Human ABCA1. |
Rabbit Polyclonal Anti-Abcc12 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abcc12 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ |
Rabbit Polyclonal Anti-Abcb10 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA |
Rabbit Polyclonal Anti-Abcb10 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD |
Rabbit Polyclonal Anti-Abcb8 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abcb8 Antibody is: synthetic peptide directed towards the middle region of Mouse Abcb8. Synthetic peptide located within the following region: ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN |
Rabbit Polyclonal Anti-ABCB8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCB8 Antibody: synthetic peptide directed towards the middle region of human ABCB8. Synthetic peptide located within the following region: EPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVG |
Rabbit Polyclonal Anti-ABCC9 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC9 Antibody: synthetic peptide directed towards the middle region of human ABCC9. Synthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK |
Rabbit Polyclonal Anti-Abca1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abca1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK |
Rabbit Polyclonal Anti-ABCD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the N terminal of human ABCD2. Synthetic peptide located within the following region: FIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQT |
Rabbit Polyclonal Anti-ABCD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the middle region of human ABCD2. Synthetic peptide located within the following region: WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT |
Rabbit Polyclonal Anti-ABCD4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the N terminal of human ABCD4. Synthetic peptide located within the following region: YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL |
Rabbit Polyclonal Anti-ABCD4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the C terminal of human ABCD4. Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA |
Rabbit Polyclonal Anti-ABCC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC1 Antibody: synthetic peptide directed towards the middle region of human ABCC1. Synthetic peptide located within the following region: LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA |
Rabbit Polyclonal Anti-ABCA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCA2 Antibody is: synthetic peptide directed towards the N-terminal region of Human ABCA2. Synthetic peptide located within the following region: ILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPS |
Rabbit Polyclonal Anti-ABCB7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCB7 Antibody is: synthetic peptide directed towards the C-terminal region of Human ABCB7. Synthetic peptide located within the following region: DEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQG |
Rabbit Polyclonal Anti-ABCC11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC11 Antibody: synthetic peptide directed towards the middle region of human ABCC11. Synthetic peptide located within the following region: NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2C7 (formerly 2C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI6H2 (formerly 6H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI4F3 (formerly 4F3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |