Antibodies

View as table Download

Gelsolin (GSN) mouse monoclonal antibody, clone 3G5, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

Gelsolin (GSN) (161-369) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 161 and 369 of Gelsolin.

Gelsolin (GSN) mouse monoclonal antibody, clone GEL-42, Purified

Applications IHC, WB
Reactivities Human, Rabbit

GSN Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human GSN

Rabbit Polyclonal Anti-GSN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN

Goat Polyclonal Antibody against GSN

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PRLKDKKMDAHP, from the internal region of the protein sequence according to NP_000168.1; NP_937895.1.