Goat Polyclonal Anti-EEA1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 1230 aa to the C-terminus of human EEA1 produced in E. coli. |
Goat Polyclonal Anti-EEA1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 1230 aa to the C-terminus of human EEA1 produced in E. coli. |
Goat Polyclonal Anti-EEA1 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 1,230 aa to the C-terminus of human EEA1 produced in E. coli. |
Rabbit Polyclonal Anti-EEA1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the N terminal of human EEA1. Synthetic peptide located within the following region: ESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDD |
Rabbit Polyclonal anti-EEA1 antibody
Applications | IHC, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the N terminal of human EEA1. Synthetic peptide located within the following region: LTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSAS |
Anti-EEA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.12~16(R-V-G-S-Q)derived from Human EEA1. |
Carrier-free (BSA/glycerol-free) EEA1 mouse monoclonal antibody, clone OTI2F6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EEA1 mouse monoclonal antibody, clone OTI2G7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
EEA1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1182-1411 of human EEA1 (NP_003557.2). |
Modifications | Unmodified |
EEA1 mouse monoclonal antibody, clone OTI2F6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
EEA1 mouse monoclonal antibody, clone OTI2F6, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
EEA1 mouse monoclonal antibody, clone OTI2F6, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
EEA1 mouse monoclonal antibody, clone OTI2F6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
EEA1 mouse monoclonal antibody, clone OTI2G7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
EEA1 mouse monoclonal antibody, clone OTI2G7, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
EEA1 mouse monoclonal antibody, clone OTI2G7, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
EEA1 mouse monoclonal antibody, clone OTI2G7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".