Antibodies

View as table Download

Anti-SPDYA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Speedy/Ringo Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human Speedy protein (within residues 200-286). This immunogen is conserved in both isoforms 1 and 2. [Swiss-Prot Q5MJ69]

Rabbit Polyclonal Anti-SPDYA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPDYA Antibody: synthetic peptide directed towards the N terminal of human SPDYA. Synthetic peptide located within the following region: MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT

Rabbit Polyclonal Anti-SPDYA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPDYA Antibody: synthetic peptide directed towards the middle region of human SPDYA. Synthetic peptide located within the following region: HTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK

SPDYA Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-313 of human SPDYA (NP_877433.2).
Modifications Unmodified

SPDYA Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-313 of human SPDYA (NP_877433.2).
Modifications Unmodified