Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
USD 380.00
In Stock
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal antibody to Activin A Receptor type IIA (activin A receptor, type IIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 267 and 513 of Activin A Receptor type IIA (Uniprot ID#P27037) |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
USD 515.00
In Stock
Rabbit Polyclonal Anti-TNFSF14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF14 antibody: synthetic peptide directed towards the middle region of human TNFSF14. Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM |
Goat Polyclonal Antibody against NGFR
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AKREEVEKLLNG, from the internal region of the protein sequence according to NP_002498.1. |
Rabbit Polyclonal CCR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit polyclonal CSFR (Ab-809) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Phospho-KDR-Y1175 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1175 of human KDR |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to BMPR2 (bone morphogenetic protein receptor, type II (serine/threonine kinase))
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 667 and 951 of BMPR2 (Uniprot ID#Q13873) |
Rabbit Polyclonal antibody to RANKL (tumor necrosis factor (ligand) superfamily, member 11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of RANKL (Uniprot ID#O14788) |
Rabbit polyclonal IL-9R (Ser519) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-9R around the phosphorylation site of serine 519 (A-R-SP-W-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CXCL1 (KC) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 78 of mouse KC |
Rabbit polyclonal anti-IL-2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-2 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-2 protein. |
Rabbit Polyclonal DR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DR5 antibody was raised against a peptide corresponding to 20 amino acids near the carboxy terminus of human DR5 precursor. The immunogen is located within the last 50 amino acids of DR5. |
Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V). |
| Modifications | Phospho-specific |
Active filters
Isotypes
- IgG
Conjugates
- Unconjugated
Pathways
- Cytokine-cytokine receptor interaction
Availabilities
- In Stock
Filter by
Category
Target Symbol
- EGFR (26)
- PDGFRB (11)
- MET (10)
- CSF1R (8)
- KDR (6)
- NGFR (6)
- CCR5 (5)
- FASLG (4)
- KIT (4)
- TNF (4)
- TNFRSF11B (4)
- BMPR2 (3)
- CCR6 (3)
- CSF2 (3)
- CSF2RA (3)
- CXCR4 (3)
- EDA (3)
- EPOR (3)
- IL10RA (3)
- IL11RA (3)
- IL17RA (3)
- IL2RA (3)
- IL2RB (3)
- LEP (3)
- PDGFB (3)
- PRL (3)
- TNFRSF10A (3)
- TNFRSF10B (3)
- TNFRSF10D (3)
- TNFRSF1A (3)
- TNFRSF21 (3)
- TNFRSF8 (3)
- TNFSF13 (3)
- TNFSF14 (3)
- VEGFA (3)
- VEGFB (3)
- ACVR1B (2)
- ACVR2A (2)
- AMH (2)
- CCL17 (2)
- CCR3 (2)
- CSF1 (2)
- CX3CR1 (2)
- EGF (2)
- FAS (2)
- FLT1 (2)
- FLT3 (2)
- GHR (2)
- IL12RB1 (2)
- IL12RB2 (2)
- IL1A (2)
- IL20 (2)
- IL21 (2)
- IL22RA1 (2)
- IL23A (2)
- IL24 (2)
- IL3 (2)
- IL4R (2)
- LTB (2)
- PDGFRA (2)
- PRLR (2)
- TGFBR1 (2)
- TGFBR2 (2)
- TNFRSF12A (2)
- TNFRSF4 (2)
- TNFSF15 (2)
- VEGFC (2)
- ACVR1 (1)
- ACVRL1 (1)
- BMP2 (1)
- BMPR1A (1)
- CCL1 (1)
- CCL15 (1)
- CCL16 (1)
- CCL2 (1)
- CCL21 (1)
- CCL23 (1)
- CCL24 (1)
- CCL26 (1)
- CCL27 (1)
- CCL28 (1)
- CCL4 (1)
- CCL7 (1)
- CCR4 (1)
- CCR8 (1)
- CCR9 (1)
- CD27 (1)
- CD40 (1)
- CRLF2 (1)
- CSF2RB (1)
- CSF3 (1)
- CSF3R (1)
- CX3CL1 (1)
- CXCL1 (1)
- CXCL10 (1)
- CXCL5 (1)
- CXCR1 (1)
- CXCR2 (1)
- CXCR5 (1)
- CXCR6 (1)
Reactivities
Antibody Hosts
Clonalities
Modifications
Families
- Druggable Genome (314)
- Transmembrane (243)
- Secreted Protein (143)
- Protein Kinase (86)
- ES Cell Differentiation/IPS (85)
- Adult stem cells (35)
- Cancer stem cells (27)
- Stem cell relevant signaling - JAK/STAT signaling pathway (27)
- GPCR (22)
- Embryonic stem cells (8)
- Transcription Factors (8)
- Stem cell - Pluripotency (7)
- Induced pluripotent stem cells (4)
- Protease (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (1)