Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against APOE
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-VGTSAAPVPSDNH, from the C Terminus of the protein sequence according to NP_000032.1. |
Rabbit polyclonal anti-MMP-1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-1 antibody. |
Rabbit anti-LIPC Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LIPC |
Rabbit anti-KNG1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KNG1 |
F12 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F12 |
Rabbit Polyclonal Anti-TNFSF14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF14 antibody: synthetic peptide directed towards the middle region of human TNFSF14. Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM |
Rabbit polyclonal Anti-TREM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TREM2 antibody: synthetic peptide directed towards the middle region of human TREM2. Synthetic peptide located within the following region: FPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASA |
Rabbit Polyclonal anti-Gastrin-1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from N-terminus of gastrin 1. |
Goat Polyclonal Antibody against ARMET
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KFCREARGKENR, from the internal region of the protein sequence according to NP_006001.2. |
Goat Polyclonal Antibody against FGF23
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RHTRSAEDDSERD, from the internal region of the protein sequence according to NP_065689.1. |
Rabbit Polyclonal antibody to C1 inhibitor (serpin peptidase inhibitor, clade G (C1 inhibitor), member 1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 77 and 420 of C1 inhibitor (Uniprot ID#P05155) |
Rabbit Anti-Periostin C-terminal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Bacterial fusion protein equivalent to a 188-amino acid polypeptide from the C-terminal region of mouse periostin which is comprised of six small alternatively-spliced exons |
USD 432.00
In Stock
Rabbit polyclonal anti-SPON2 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPON2. |
Rabbit polyclonal anti-MASP2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MASP2. |
WISP2 Rabbit Polyclonal (aa102-117) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | WISP2 antibody was raised against synthetic peptide from human WISP2. |
Rabbit polyclonal APOE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human APOE. |
Rabbit Polyclonal Anti-C1QA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1QA antibody: synthetic peptide directed towards the N terminal of human C1QA. Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG |
Rabbit Polyclonal CTRP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CTRP3 antibody was raised against a 16 amino acid synthetic peptide from near the center of human CTRP3. The immunogen is located within amino acids 90 - 140 of CTRP3. |
Rabbit polyclonal antibody to TBG (serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 7)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 371 of TBG (Uniprot ID#P05543) |
Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801) |
Rabbit polyclonal IL-9R (Ser519) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-9R around the phosphorylation site of serine 519 (A-R-SP-W-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CXCL1 (KC) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 78 of mouse KC |
Rabbit polyclonal anti-IL-2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-2 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-2 protein. |
Anti-Human IGF-I Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IGF-I |
Active filters
Isotypes
- IgG
Families
- Secreted Protein
Availabilities
- In Stock
Filter by
Category
Target Symbol
- EGFR (26)
- FN1 (8)
- AFP (6)
- AGT (6)
- ERBB3 (6)
- GCG (6)
- MUC1 (6)
- TNC (6)
- DEFA1 (5)
- GDF15 (5)
- HSD17B13 (5)
- STX1A (5)
- SYT1 (5)
- AMPH (4)
- APOH (4)
- BMP3 (4)
- DKK3 (4)
- EIF2AK3 (4)
- EPHA3 (4)
- F13A1 (4)
- FASLG (4)
- FGFR2 (4)
- GNAS (4)
- IGFBP3 (4)
- LGALS3 (4)
- LOX (4)
- NPPB (4)
- SPP1 (4)
- TNF (4)
- TNFRSF11B (4)
- ACE (3)
- ADAMTS18 (3)
- ADCK1 (3)
- ADM (3)
- AGR3 (3)
- ANXA2 (3)
- APOL1 (3)
- B2M (3)
- BDNF (3)
- CSF2 (3)
- CSF2RA (3)
- EDA (3)
- EPOR (3)
- FGB (3)
- FSTL1 (3)
- HP (3)
- IL18BP (3)
- IL1RN (3)
- KLK11 (3)
- KLK8 (3)
- LEP (3)
- MMP1 (3)
- MSLN (3)
- NRG1 (3)
- PGF (3)
- PRL (3)
- PTHLH (3)
- RETN (3)
- SERPINB5 (3)
- SERPING1 (3)
- TIMP4 (3)
- TNFRSF1A (3)
- TNFSF13 (3)
- TNFSF14 (3)
- TTR (3)
- VEGFA (3)
- VEGFB (3)
- A1BG (2)
- ABO (2)
- ACE2 (2)
- ACP6 (2)
- ADAMTS1 (2)
- ADAMTSL1 (2)
- ADGRE5 (2)
- ADIPOQ (2)
- AGRP (2)
- AMH (2)
- ANGPT1 (2)
- ANGPTL4 (2)
- APOA1 (2)
- APOE (2)
- ARSF (2)
- ARSK (2)
- ARTN (2)
- BGLAP (2)
- BGN (2)
- BPIFB2 (2)
- CBLN1 (2)
- CCL17 (2)
- CCN3 (2)
- CD5L (2)
- CFHR1 (2)
- CHGA (2)
- CHGB (2)
- CLU (2)
- COL20A1 (2)
- COX16 (2)
- CRP (2)
- CSF1 (2)
- CST2 (2)
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Cytokine-cytokine receptor interaction (145)
- Pathways in cancer (120)
- MAPK signaling pathway (74)
- Focal adhesion (72)
- Regulation of actin cytoskeleton (64)
- Melanoma (48)
- Jak-STAT signaling pathway (47)
- Bladder cancer (40)
- Endocytosis (40)
- Pancreatic cancer (40)
- Complement and coagulation cascades (38)
- Prostate cancer (37)
- Calcium signaling pathway (36)
- ErbB signaling pathway (36)
- ECM-receptor interaction (32)
- GnRH signaling pathway (32)
- Hematopoietic cell lineage (31)
- Gap junction (30)
- Glioma (29)
- Colorectal cancer (28)
- Epithelial cell signaling in Helicobacter pylori infection (27)
- Non-small cell lung cancer (27)
- Wnt signaling pathway (27)
- Adherens junction (26)
- Dorso-ventral axis formation (26)
- Endometrial cancer (26)
- Melanogenesis (25)
- Hedgehog signaling pathway (24)
- TGF-beta signaling pathway (24)
- Basal cell carcinoma (22)
- Apoptosis (20)
- Natural killer cell mediated cytotoxicity (18)
- Type I diabetes mellitus (18)
- Adipocytokine signaling pathway (17)
- Chemokine signaling pathway (17)
- Alzheimer's disease (16)
- Neuroactive ligand-receptor interaction (16)
- Small cell lung cancer (16)
- Toll-like receptor signaling pathway (16)
- Allograft rejection (15)
- Graft-versus-host disease (15)
- mTOR signaling pathway (15)
- Renal cell carcinoma (14)
- p53 signaling pathway (14)
- Autoimmune thyroid disease (13)
- PPAR signaling pathway (13)
- Renin-angiotensin system (13)
- Dilated cardiomyopathy (12)
- Metabolic pathways (12)
- T cell receptor signaling pathway (12)
- Fc epsilon RI signaling pathway (11)
- Hypertrophic cardiomyopathy (HCM) (11)
- Asthma (10)
- Neurotrophin signaling pathway (10)
- Systemic lupus erythematosus (10)
- Amyotrophic lateral sclerosis (ALS) (8)
- NOD-like receptor signaling pathway (8)
- RIG-I-like receptor signaling pathway (8)
- Type II diabetes mellitus (8)
- Antigen processing and presentation (7)
- Axon guidance (7)
- Fc gamma R-mediated phagocytosis (7)
- Long-term depression (7)
- Cytosolic DNA-sensing pathway (6)
- SNARE interactions in vesicular transport (6)
- Prion diseases (5)
- Regulation of autophagy (5)
- Maturity onset diabetes of the young (4)
- Oocyte meiosis (4)
- Progesterone-mediated oocyte maturation (4)
- Taste transduction (4)
- Vascular smooth muscle contraction (4)
- Vibrio cholerae infection (4)
- Cell cycle (3)
- Huntington's disease (3)
- VEGF signaling pathway (3)
- Cell adhesion molecules (CAMs) (2)
- Chronic myeloid leukemia (2)
- Glycerolipid metabolism (2)
- Glycosaminoglycan degradation (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Histidine metabolism (2)
- Insulin signaling pathway (2)
- Primary immunodeficiency (2)
- Riboflavin metabolism (2)
- Acute myeloid leukemia (1)
- Arginine and proline metabolism (1)
- Folate biosynthesis (1)
- N-Glycan biosynthesis (1)
- Nitrogen metabolism (1)
- Pathogenic Escherichia coli infection (1)
- Proteasome (1)
- Starch and sucrose metabolism (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- Viral myocarditis (1)
- beta-Alanine metabolism (1)