Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3C2-4
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3G11-14
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 4A5-19
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5F4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5G12-21
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6F5-23
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6H8-22
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8E8-2
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8F6-6
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 9G5-20
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 12G4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 15C4-8
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 16F12-11
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli. |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
ERBB2 Capture mouse monoclonal antibody, Luminex validated, clone OTI12G4
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700215 |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Active filters
Reactivities
- Human
Pathways
- Endometrial cancer
Availabilities
- In Stock
Filter by
Category
Target Symbol
- ERBB2 (107)
- MAP2K1 (86)
- TP53 (83)
- EGFR (73)
- CTNNB1 (53)
- BRAF (44)
- AKT1 (35)
- MLH1 (31)
- PIK3CG (26)
- CDH1 (25)
- HRAS (23)
- KRAS (23)
- MAPK1 (21)
- PIK3R5 (19)
- AKT2 (17)
- MYC (17)
- PIK3CD (15)
- CCND1 (12)
- FOXO3 (12)
- MAP2K2 (12)
- ARAF (9)
- MAPK3 (9)
- RAF1 (9)
- APC (8)
- BAD (8)
- PIK3CA (8)
- CASP9 (7)
- EGF (7)
- ELK1 (6)
- AKT3 (5)
- NRAS (5)
- ILK (4)
- PTEN (4)
- PDPK1 (3)
- GRB2 (2)
- LEF1 (2)
- PIK3R3 (2)
- AXIN1 (1)
- AXIN2 (1)
- CTNNA1 (1)
- GSK3B (1)
- PIK3CB (1)
- PIK3R1 (1)
- PIK3R2 (1)
- SOS2 (1)
- TCF7 (1)
- TCF7L1 (1)
- TCF7L2 (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (842)
- Protein Kinase (435)
- ES Cell Differentiation/IPS (255)
- Transmembrane (212)
- Transcription Factors (176)
- Stem cell - Pluripotency (119)
- Stem cell relevant signaling - JAK/STAT signaling pathway (102)
- Adult stem cells (82)
- Cancer stem cells (73)
- Secreted Protein (73)
- Stem cell relevant signaling - Wnt Signaling pathway (30)
- Induced pluripotent stem cells (25)
- Embryonic stem cells (24)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (17)
- Stem cell relevant signaling - DSL/Notch pathway (12)
- Protease (7)
- Phosphatase (4)