Rabbit polyclonal Bcl-6 (Ser333) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bcl-6 around the phosphorylation site of serine 333 (P-Q-SP-P-Q). |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-BCL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BCL6 antibody is: synthetic peptide directed towards the C-terminal region of Human BCL6. Synthetic peptide located within the following region: IHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP |
Complement C3 (C3) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding to C3d |
bcl 6 (BCL6) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 675-704 amino acids from the C-terminal region of human BCL6 |
Rabbit Polyclonal BCL6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | BCL6 antibody was raised against an 18 amino acid synthetic peptide near the center of human BCL6. |
Rabbit polyclonal Bcl-6 (Ab-333) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Bcl-6 around the phosphorylation site of serine 333 (P-Q-SP-P-Q). |
Rabbit anti BCL-6 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
BCL6 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human BCL6 (NP_001697.2). |
| Modifications | Unmodified |
Bcl6 Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human BCL6. AA range:271-320 |
Germany
Japan
United Kingdom
China
