Rabbit anti-ENO1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ENO1 |
Rabbit anti-ENO1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ENO1 |
Rabbit polyclonal ENO1 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit polyclonal CNOT2 (Ab-101) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
Rabbit polyclonal CNOT2 (Ser101) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK |
Rabbit Polyclonal CNOT4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Xenopus |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 50-100 of human CNOT4 was used as the immunogen for the antibody. |
Goat Polyclonal Antibody against DCP1A
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QVLTKNKDNHN, from the C Terminus of the protein sequence according to NP_060873.3. |
Rabbit Polyclonal CNOT4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CNOT4 antibody was raised against a 19 amino acid peptide near the amino terminus of the human CNOT4. |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI4C7 (formerly 4C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI3B8 (formerly 3B8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI7D7 (formerly 7D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI4D6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI1G5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI4E12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI2D3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI3G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI4C9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI1G7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI2D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI6D7 (formerly 6D7)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ENO1 |
CNOT4 mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI4C7 (formerly 4C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI4C7 (formerly 4C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI3B8 (formerly 3B8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI3B8 (formerly 3B8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |