Rabbit anti-HADHA Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HADHA |
Rabbit anti-HADHA Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HADHA |
HSD17B12 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 133~163 amino acids from the Center region of human 17-beta-HSD12 / HSD17B12 |
Rabbit Polyclonal antibody to PECR (peroxisomal trans-2-enoyl-CoA reductase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 241 and 303 of PECR (Uniprot ID#Q9BY49) |
Rabbit polyclonal HADHA Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HADHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 737-763 amino acids from the C-terminal region of human HADHA. |
Rabbit polyclonal anti-TFP1/HADHA antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 750 of human TFP1 |
Rabbit Polyclonal Anti-Hsd17b12 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hsd17b12 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hsd17b12. Synthetic peptide located within the following region: SAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS |
Carrier-free (BSA/glycerol-free) PECR mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PECR mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PECR mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PECR mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PECR mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ACOX1 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA oxidase 1, palmitoyl |
Anti-ACOX1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA oxidase 1, palmitoyl |
Rabbit Polyclonal Anti-HSD17B12 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD17B12 |
Anti-PECR mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Anti-PECR mouse monoclonal antibody, clone OTI2B2 (formerly 2B2), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Biotin |
Anti-PECR mouse monoclonal antibody, clone OTI2B2 (formerly 2B2), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | HRP |
Anti-PECR mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
PECR mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PECR mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
PECR mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
PECR mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-PECR mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-PECR mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-PECR mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-PECR mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PECR mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PECR mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
PECR mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
PECR mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PECR mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PECR mouse monoclonal antibody, clone OTI1E4 (formerly 1E4), Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
PECR mouse monoclonal antibody, clone OTI1E4 (formerly 1E4), HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
PECR mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HADHA mouse monoclonal antibody,clone OTI7B3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HADHA mouse monoclonal antibody,clone OTI7B3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |