Antibodies

View as table Download

Rabbit anti-DCK Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DCK

Rabbit Polyclonal antibody to DCK (deoxycytidine kinase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 260 of DCK (Uniprot ID#P27707)

Rabbit Polyclonal DCK Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-DCK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCK antibody: synthetic peptide directed towards the middle region of human DCK. Synthetic peptide located within the following region: QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD

Rabbit Polyclonal Anti-DCK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCK antibody: synthetic peptide directed towards the middle region of human DCK. Synthetic peptide located within the following region: ATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQ

Carrier-free (BSA/glycerol-free) DCK mouse monoclonal antibody, clone OTI16E12 (formerly 16E12)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCK mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCK mouse monoclonal antibody, clone OTI16G6 (formerly 16G6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCK mouse monoclonal antibody, clone OTI15E12 (formerly 15E12)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-DCK Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DCK

DCK mouse monoclonal antibody, clone OTI16E12 (formerly 16E12)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DCK mouse monoclonal antibody, clone OTI16E12 (formerly 16E12)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

DCK mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DCK mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

DCK mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

DCK mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

DCK mouse monoclonal antibody, clone OTI16G6 (formerly 16G6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DCK mouse monoclonal antibody, clone OTI16G6 (formerly 16G6), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

DCK mouse monoclonal antibody, clone OTI16G6 (formerly 16G6), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

DCK mouse monoclonal antibody, clone OTI16G6 (formerly 16G6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

DCK mouse monoclonal antibody, clone OTI15E12 (formerly 15E12)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DCK mouse monoclonal antibody, clone OTI15E12 (formerly 15E12), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

DCK mouse monoclonal antibody, clone OTI15E12 (formerly 15E12)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".