Rabbit Polyclonal Anti-ACAA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD |
Rabbit polyclonal anti-YOD1 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human YOD1. |
Rabbit polyclonal anti-SCD (stearoyl-CoA desaturase) antibody
| Applications | WB |
| Reactivities | Hamster, Human, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 206 of rat SCD |
Goat Polyclonal Antibody against FADS1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QPSFEPTKNKELTDE, from the internal region of the protein sequence according to NP_037534.2. |
Rabbit polyclonal anti-TFP1/HADHA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 750 of human TFP1 |
Anti-ACOT1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA thioesterase 1 |
Anti-ACOT2 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 169-468 amino acids of human acyl-CoA thioesterase 2 |
Anti-ACOX3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 325-625 amino acids of human acyl-CoA oxidase 3, pristanoyl |
Anti-ACOX1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA oxidase 1, palmitoyl |
Rabbit Polyclonal Anti-FADS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FADS1 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
