CD79A rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD79A |
CD79A rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD79A |
Rabbit polyclonal anti-CD79A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CD79A. |
Mouse Monoclonal CD79a Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CD79A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD79A antibody is: synthetic peptide directed towards the C-terminal region of Human CD79A. Synthetic peptide located within the following region: AVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRG |
Mouse monoclonal Anti-CD79a Clone HM57
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Opossum, Primate, Rabbit, Rat, Pig, Horse |
Conjugation | Unconjugated |
Mouse monoclonal Anti-CD79a Clone JCB117
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-CD17a Clone HM47
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Opossum, Primate, Rabbit, Rat, Pig, Horse |
Conjugation | Unconjugated |
Rabbit anti CD79a Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD79A mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HAO1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD79A |
CD79a Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 33-145 of human CD79a (NP_001774.1). |
Modifications | Unmodified |
CD79a Rabbit polyclonal Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human CD79a |
CD79a Mouse monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthesized peptide derived from human CD79a |
CD79a (10A10) Mouse monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD79A mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD79A mouse monoclonal antibody,clone 5E2, Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
CD79A mouse monoclonal antibody,clone 5E2, HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
CD79A mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".