Antibodies

View as table Download

HDAC1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen N term -peptide of human HDAC1

Rabbit polyclonal anti-Cyclin E1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin E1.

Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706
Modifications Phospho-specific

Rabbit Polyclonal STAT5A (Ser780) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Serine 780
Modifications Phospho-specific

Rabbit Polyclonal STAT5A/B (Ser725/730) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT5A/B around the phosphorylation site of Serine 725/730
Modifications Phospho-specific

CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCND1

Phospho-STAT6-Y641 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y641 of human STAT6
Modifications Phospho-specific

Goat Polyclonal Anti-Histone Deacetylase 1 Antibody

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen The immunogen for Anti-Histone Deacetylase 1 Antibody: Peptide with sequence C-KPEAKGVKEEVK, from the C Terminus of the protein sequence according to NP_004955.2.

Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K).
Modifications Phospho-specific

Rabbit polyclonal Notch 1 (Cleaved-Val1744) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Notch 1.

Goat Polyclonal Antibody against SMO (Internal region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QSDDEPKRIKKS, from the internal region of the protein sequence according to NP_005622.1.

Rabbit polyclonal anti-HDAC1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HDAC1.

Rabbit polyclonal anti-DELTA-4 antibody

Applications IHC, WB
Reactivities Human, partial reactivity to Mouse and Rat
Conjugation Unconjugated
Immunogen Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4.

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal anti-HDAC1 antibody, Loading control

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 70-99 amino acids from the N-terminal region of human HDAC1.

Rabbit Polyclonal STAT6 (Tyr641) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT6 around the phosphorylation site of Tyrosine 641
Modifications Phospho-specific

Rabbit Polyclonal Anti-Notch 1 (Cleaved-Val1744) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Notch 1 (Cleaved-Val1744) Antibody: A synthesized peptide derived from human Notch 1 (Cleaved-Val1744)

Rabbit Polyclonal Anti-HDAC1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen HDAC1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human HDAC1.

Rabbit polyclonal anti-STAT5A/B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human STAT5A/B.

Rabbit polyclonal anti-STAT5A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human STAT5A.

Rabbit Polyclonal Cyclin D1 Antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Thr286.

Rabbit Polyclonal Cyclin D1 (Ser90) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Serine 90
Modifications Phospho-specific

Rabbit Polyclonal CD44 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CD44

Rabbit Polyclonal HDAC1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HDAC1

Rabbit Polyclonal STAT5A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT5A

Rabbit Polyclonal STAT5A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT5A

Rabbit Polyclonal STAT5A (Tyr694) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Tyrosine 694
Modifications Phospho-specific

Rabbit Polyclonal STAT6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT6

Goat Polyclonal Antibody against WISP1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ESYPDFSEIAN, from the C Terminus of the protein sequence according to NP_003873.1; NP_543028.1.

Rabbit anti-STAT5A (Phospho-Ser780) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of serine 780 (R-L-SP-P-P).
Modifications Phospho-specific

Rabbit polyclonal anti-SMO antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SMO.

Rabbit polyclonal anti-NOTCH 1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues of human Notch 1 located near the N-terminal sequence of the cleaved N intracellular domain (NICD).

Rabbit polyclonal HDAC1 Antibody (Center S423)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-430 amino acids from the Central region of human HDAC1.

Rabbit Polyclonal Cyclin D1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Cyclin D1

Rabbit Polyclonal Cyclin E1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Cyclin E1.

Rabbit Polyclonal HDAC1 (Ser421) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HDAC1 around the phosphorylation site of Serine 421
Modifications Phospho-specific

Rabbit Polyclonal STAT6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT6

Rabbit Polyclonal STAT6 (Thr645) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT6 around the phosphorylation site of Threonine 645
Modifications Phospho-specific

Rabbit Polyclonal Anti-DLL1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP

Goat Anti-DLL1 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-ATQRHLTVGEEWSQD, from the internal region of the protein sequence according to NP_005609.3.

Rabbit polyclonal HDAC1 Antibody(C-term)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 421-450 amino acids from the C-terminal region of human HDAC1.

Rabbit Polyclonal HDAC1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human HDAC1.

Goat Anti-DLL4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence KNTNQKKELEVDC, from the internal region of the protein sequence according to NP_061947.1.

Rabbit Polyclonal HES-1 Antibody

Applications IHC
Reactivities Bovine, Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A portion of amino acids 230-280 of human HES1 was used as the immunogen.

Rabbit anti Cyclin D1 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human cyclin D1 protein. This sequence is identical to human, mouse, rat.

Rabbit anti STAT5a Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti STAT6 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-CCNE1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 398-410 amino acids of Human Cyclin E1

Anti-NOTCH1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2541-2555 amino acids of Human notch 1

Anti-NOTCH1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2541-2555 amino acids of human notch 1