Rabbit Polyclonal Anti-MKRN3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MKRN3 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human MKRN3. |
Rabbit Polyclonal Anti-MKRN3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MKRN3 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human MKRN3. |
Rabbit Polyclonal Vinculin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Vinculin antibody was raised against a 16 amino acid peptide near the carboxy terminus of human Vinculin. |
Rabbit polyclonal anti-Vinculin antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human VCL |
Rabbit Polyclonal Anti-vinculin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-vinculin Antibody: A synthesized peptide derived from human vinculin |
Rabbit Polyclonal Vinculin (Tyr821) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Vinculin around the phosphorylation site of Tyrosine 821 |
Modifications | Phospho-specific |
Rabbit Polyclonal Vinculin Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Vinculin |
Rabbit Polyclonal Anti-Vinculin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Vinculin antibody was raised against a 23 amino acid peptide near the amino of human Vinculin. |
Rabbit Polyclonal Anti-VCL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VCL antibody: synthetic peptide directed towards the C terminal of human VCL. Synthetic peptide located within the following region: PRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAA |
Rabbit Polyclonal Anti-Vinculin Antibody (biotin)
Applications | WB |
Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Biotin-Vinculin antibody was raised against a 23 amino acid peptide near the amino terminus of human Vinculin. |
Anti-VCL Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 811-824 amino acids of human vinculin |