Antibodies

View as table Download

Rabbit Polyclonal Anti-PDYN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Pdyn antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLTVSGLRGKDDLEDEVALEEGYSALAKLLEPVLKELEKSRLLTSVPEEK

Rabbit Polyclonal Anti-PDYN Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDYN antibody: synthetic peptide directed towards the middle region of human PDYN. Synthetic peptide located within the following region: SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE

Rabbit polyclonal anti Dynorphin A; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu- Lys-Trp-Asp-Asn-Gln-OH coupled to carrier protein.

Rabbit polyclonal anti Dynorphin A (1-13); neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu- Lys-OH coupled to carrier protein.

Rabbit polyclonal anti Dynorphin B; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val- Thr-OH coupled to carrier protein.

Rabbit polyclonal anti Dynorphin A (3-14), neat antiserum

Applications ELISA
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp- OH coupled to carrier protein.

Guinea pig polyclonal anti Dynorphin B; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val- Thr-OH coupled to carrier protein.

Guinea pig polyclonal anti Dynorphin B; diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val- Thr-OH coupled to carrier protein.

Rabbit polyclonal antibody to PDYN (prodynorphin)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 196 of PDYN (Uniprot ID#P01213)

Rabbit polyclonal anti Dynorphin A; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu- Lys-OH coupled to carrier protein.

Rabbit polyclonal anti Dynorphin A (1-8); diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated

Rabbit polyclonal anti Dynorphin A; diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu- Lys-OH coupled to carrier protein.

Rabbit polyclonal anti Dynorphin A (1-8); purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH coupled to carrier protein.

Rabbit polyclonal anti Dynorphin A (1-13); diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH coupled to carrier protein.

Rabbit polyclonal anti Dynorphin B; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val- Thr-OH coupled to carrier protein.

Rabbit polyclonal anti Dynorphin A (1-13); purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu- Lys-OH coupled to carrier protein.

Rabbit polyclonal anti Dynorphin A (1-10) amide; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2 coupled to carrier protein.

Rabbit polyclonal anti Dynorphin A (1-10) amide; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2 coupled to carrier protein.

Rabbit polyclonal anti Leumorphin (hu); neat antiserum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val- Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Ser-Gly-Glu-Leu-Phe-Asp-Ala- OH coupled to carrier protein.

Rabbit polyclonal anti a-Neoendorphin; diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Pro-Lys-OH coupled to carrier protein.

Rabbit polyclonal anti a-Neoendorphin; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Pro-Lys-OH coupled to carrier protein.

Rabbit polyclonal anti a-Neoendorphin; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Pro-Lys-OH coupled to carrier protein.

PDYN Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-254 of human PDYN (NP_077722.1).
Modifications Unmodified