Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Rabbit Polyclonal Anti-ABCB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM |
Rabbit Polyclonal Anti-CFTR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CFTR antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CFTR. |
Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2) |
TAP2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TAP2 |
Goat Polyclonal Antibody against ABCC8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2. |
Rabbit Polyclonal Anti-ABCG2(CD338) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Rabbit Polyclonal Anti-Abca7 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
Rabbit Polyclonal Anti-ABCB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV |
Rabbit anti-ABCD3 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from human ABCD3. |
Rabbit Polyclonal Anti-ABCG5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCG5 Antibody: synthetic peptide directed towards the middle region of human ABCG5. Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH |
Goat Polyclonal Antibody against ABCB5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QTQHRNTSKKAQ, from the internal region of the protein sequence according to NP_848654.3. |
Goat Polyclonal Antibody against ABCC5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KDIDIGKEYIIP-C, from the N Terminus of the protein sequence according to NP_005679.2; NP_001018881.1. |
Goat Anti-ABCC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HQSDLKVDENQKAYY, from the internal region of the protein sequence according to NP_004987.2; NP_063915.2; NP_063953.2;NP_063954.2; NP_063955.2. |
Rabbit Polyclonal Anti-ABCA12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCA12 Antibody: synthetic peptide directed towards the middle region of human ABCA12. Synthetic peptide located within the following region: TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV |
Rabbit Polyclonal Anti-ABCB6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCB6 antibody: synthetic peptide directed towards the middle region of human ABCB6. Synthetic peptide located within the following region: VTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI |
Rabbit polyclonal anti-ABCB10 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCB10. |
Rabbit polyclonal anti-ABCD4 antibody
Applications | WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCD4. |
Rabbit polyclonal anti-ABCD1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCD1. |
Rabbit polyclonal anti-ABCB7 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCB7. |
Rabbit polyclonal anti-ABCA8 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCA8. |
Rabbit polyclonal anti-ABCA6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ABCA6. |
Rabbit polyclonal anti-ABCB1 antibody
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 262-277 of human ABCB1 protein. |
Anti-ABCG1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 349-362 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 1 |
Rabbit Polyclonal Anti-TAP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
Rabbit Polyclonal Anti-Abcc2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abcc2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA |
Rabbit Polyclonal Anti-ABCC8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW |
Rabbit Polyclonal ABCB5 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal ABCA8 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal ABCG2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal ABCG2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
ABCB5 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide |
Goat Anti-ABCD4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RDDIDNPDQRISQD, from the internal region of the protein sequence according to NP_005041.1. |
Goat Anti-ABCD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EDMQRKGYSEQD, from the internal region of the protein sequence according to NP_000024.2. |
Goat Anti-ABCA9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QRVVQELEMENIQD, from the internal region of the protein sequence according to NP_525022.2. |
Goat Anti-MRP8 / ABCC11 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KVVEFDRPEVLRK, from the internal region (near C Terminus) of the protein sequence according to NP_115972.2; NP_660187.1. |
Rabbit anti-ABCB8 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCB8. |
Rabbit anti-ABCD4 polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCD4. |
Rabbit anti-ABCB10 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCB10. |
Rabbit anti-ABCB5 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCB5 (910-940 amino acid region) |
Rabbit polyclonal anti-ABCC10 (MRP7) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MRP7. |
TAP2 Rabbit Polyclonal (aa689-703) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | TAP2 antibody was raised against synthetic peptide from human TAP2. |
Rabbit Polyclonal ABCA7 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ABCA7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human ABCA7. |
Anti-ABCC5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human ATP-binding cassette, sub-family C? |
Anti-ABCG2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Rabbit Polyclonal Anti-ABCB9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCB9 Antibody: synthetic peptide directed towards the N terminal of human ABCB9. Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW |
Rabbit Polyclonal Anti-ABCA5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCA5 Antibody: synthetic peptide directed towards the C terminal of human ABCA5. Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI |