Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-cardiac troponin T Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Feline, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-cardiac troponin T Antibody: Peptide with sequence C-RNRINDNQKVSKT, from the C Terminus of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
Rabbit Polyclonal Anti-TPM1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the middle region of human TPM1. Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED |
Rabbit polyclonal anti-ATP1A1(NaK ATPase) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATP1A1 |
Rabbit Polyclonal Nhe-1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nhe-1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of the human Nhe-1. The immunogen is located within the last 50 amino acids of Nhe-1. |
Rabbit Polyclonal Nhe-1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nhe-1 antibody was raised against a 17 amino acid synthetic peptide near the center of the human Nhe-1. The immunogen is located within amino acids 490 - 540 of Nhe-1. |
Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698) |
Rabbit Polyclonal ATPase Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ATPase |
Rabbit Polyclonal ATPase (Ser16) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ATPase around the phosphorylation site of Serine 16 |
| Modifications | Phospho-specific |
Rabbit Polyclonal TNNI3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 |
Rabbit Polyclonal TNNI3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 |
Rabbit Polyclonal TNNI3 (Ser43) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 around the phosphorylation site of Serine 43 |
| Modifications | Phospho-specific |
Rabbit Polyclonal TNNI3 (Thr142) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 around the phosphorylation site of Threonine 142 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-human CaV1.2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide VNENTRMYIPEENHQ(C), corresponding to amino acid residues 2-15 of human Cav1.2 (exon 1B). Intracellular, N-terminus. |
Rabbit polyclonal antibody to CACNG5 (calcium channel, voltage-dependent, gamma subunit 5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 43 and 246 of CACNG5 (Uniprot ID#Q9UF02) |
Rabbit polyclonal anti-CACNG1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG1. |
Rabbit polyclonal anti-CACNA2D4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNA2D4. |
Rabbit polyclonal CACNA2D3 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNA2D3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1026-1053 amino acids from the C-terminal region of human CACNA2D3. |
Goat Anti-SERCA2 / ATP2A2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DELNPSAQRDACLN, from the internal region of the protein sequence according to NP_001672.1; NP_733765.1. |
Rabbit Polyclonal Anti-Cacng1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIIGSICAFL |
Goat Polyclonal Antibody against CACNB4 (internal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DYPDSYQDTYKPH, from the internal region (near the C Terminus) of the protein sequence according to NP_001005747.1; NP_000717.2; NP_001005746.1. |
Goat Anti-CACNB2 (aa565-579) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ECNKQRSRHKSKDRY, from the C Terminus of the protein sequence according to NP_000715.2; NP_963890.2; NP_963884.2; NP_963891.1; NP_963887.2; NP_963865.2; NP_963864.1; NP_963866.2; NP_001161417.1. |
Rabbit polyclonal anti-CACNG7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG7. |
Anti-ATP2A2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 111-253 amino acids of human ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 |
Rabbit Polyclonal Anti-Cacnb2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Cacnb2 antibody is: synthetic peptide directed towards the middle region of Rat Cacnb2. Synthetic peptide located within the following region: DFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQ |
Rabbit anti Troponin I Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to inter-segment of human Troponin I Cardiac isoform protein. |
Anti-ATP1A1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 897-911 amino acids of human ATPase, Na+/K+ transporting, alpha 1 polypeptide |
Anti-ATP1A1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 28-40 amino acids of human ATPase, Na+/K+ transporting, alpha 1 polypeptide |
Anti-TPM1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-TNNI3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-MYL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MYL3 |
USD 345.00
In Stock
Rabbit Polyclonal Anti-UQCRC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UQCRC1 |
Active filters
Reactivities
- Rat
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Cardiac muscle contraction