Antibodies

View as table Download

Rabbit anti-BIRC7 Polyclonal Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Recombinant protein of human BIRC7

Rabbit Polyclonal Livin Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Livin antibody was raised with a synthetic peptide corresponding to amino acids 264 to 280 of the short form and 281 to 298 of the long form of human Livin (1,3) This sequence is identical between a and b forms of the Livin proteins .

Rabbit polyclonal antibody to ML-IAP (baculoviral IAP repeat-containing 7)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 241 of Livin (Uniprot ID#Q96CA5)

Rabbit Polyclonal antibody to Livin (baculoviral IAP repeat-containing 7)

Applications IF, IHC
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 13 and 242 of Livin (Uniprot ID#Q96CA5)

Livin (BIRC7) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human

Goat Polyclonal Antibody against LIVIN / BIRC7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RAPVRSRVRT, from the C Terminus of the protein sequence according to NP_647478.1; NP_071444.1.

Rabbit Polyclonal Anti-BIRC7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BIRC7 antibody: synthetic peptide directed towards the middle region of human BIRC7. Synthetic peptide located within the following region: EERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL

Anti-BIRC7 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein