Antibodies

View as table Download

Rabbit polyclonal antibody to CACNA1B (calcium channel, voltage-dependent, N type, alpha 1B subunit)

Applications IF, IP, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 2013 and 2209 of CACNA1B (Uniprot ID#Q00975)

Rabbit Polyclonal Anti-CACNA1H Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CACNA1H antibody was raised against a 16 amino acid peptide near the center of human CACNA1H.

Goat Anti-CACNA1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5.

Rabbit Polyclonal Anti-DIRAS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen DIRAS3 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DIRAS3.

Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698)

Rabbit Polyclonal Anti-human CaV1.2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide VNENTRMYIPEENHQ(C), corresponding to amino acid residues 2-15 of human Cav1.2 (exon 1B). Intracellular, N-terminus.

Rabbit polyclonal anti-CACNA1H antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CACNA1H.

Rabbit Polyclonal Anti-CACNA1I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA1I antibody: synthetic peptide directed towards the middle region of human CACNA1I. Synthetic peptide located within the following region: LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS

Rabbit Polyclonal Anti-CACNA1C Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from internal region of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Marmoset (94%).

Rabbit Polyclonal Anti-CACNA1C Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from C-Terminus of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset (94%); Elephant (88%).

Rabbit Polyclonal Anti-CACNA1C Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNA1C

Rabbit Polyclonal Anti-CACNA1D Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNA1D

Rabbit Polyclonal Anti-CACNA1E Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNA1E

Rabbit Polyclonal Anti-CACNA1A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNA1A

Rabbit Polyclonal Anti-CACNA1G Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNA1G