Antibodies

View as table Download

Rabbit Polyclonal Rel Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Rel

Rabbit Polyclonal Rel (Ser503) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Rel around the phosphorylation site of Serine 503
Modifications Phospho-specific

c Rel (REL) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 470-520 of Human c-Rel.

Goat Anti-REL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence NDLNASNACIYN, from the internal region of the protein sequence according to NP_002899.1.

c Rel (REL) rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human
Immunogen Synthesized non-phosphopeptide derived from human Rel around the phosphorylation site of serine 503 (T-S-SP-D-S)

c Rel (REL) rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human
Immunogen Synthesized non-phosphopeptide derived from human Rel around the phosphorylation site of serine 503 (T-S-SP-D-S)

Rabbit Polyclonal Anti-REL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REL antibody: synthetic peptide directed towards the N terminal of human REL. Synthetic peptide located within the following region: ASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQ

Phospho-REL-S503 Rabbit Polyclonal Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S503 of human REL
Modifications Phospho-specific

Rabbit Polyclonal Anti-REL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-REL Antibody: synthetic peptide directed towards the middle region of human REL. Synthetic peptide located within the following region: CADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQ

Rabbit Polyclonal Anti-Rel Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rel antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF

Rabbit anti Rel (pS503) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -CSVNMMTTS-S-DSMGETD- with phosphorylation sites at Ser503 of c-Rel protein from human.

Rabbit Polyclonal Anti-REL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human REL