Antibodies

View as table Download

Rabbit Polyclonal ATF6 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ATF6 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human ATF6.

Rabbit Polyclonal ATF6 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ATF6 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ATF6. The immunogen is located within amino acids 30 - 80 of ATF6.

ATF6 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human, Rabbit
Immunogen Synthetic peptide from C-terminus of human ATF6

ATF6 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human ATF6

ATF6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 356~386 amino acids from the Center region of Human ATF6.

Rabbit Polyclonal Anti-Atf6 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Atf6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVST

Rabbit Polyclonal ATF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human ATF6 protein (within residues 200-350). [Swiss-Prot P18850]

Rabbit Polyclonal anti-ATF6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF6 antibody: synthetic peptide directed towards the N terminal of human ATF6. Synthetic peptide located within the following region: GYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKD

Rabbit Polyclonal Anti-ATF6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATF6

ATF6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ATF6