Rabbit Polyclonal Anti-TRPC6 (extracellular)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DNVKYYNLARIKWD, corresponding to amino acid residues 573-586 of rat TRPC6. 2nd extracellular loop. |
Rabbit Polyclonal Anti-TRPC6 (extracellular)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DNVKYYNLARIKWD, corresponding to amino acid residues 573-586 of rat TRPC6. 2nd extracellular loop. |
Rabbit Polyclonal TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6. |
Rabbit Polyclonal TRPC6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC6. |
Rabbit Polyclonal Anti-TRPC6 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the N terminal of human TRPC6. Synthetic peptide located within the following region: MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC |
Rabbit Polyclonal Anti-TRPC6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RRNESQDYLLMDELG, corresponding to amino acid residues 24-38 of mouse TRPC6. Intracellular, N-terminus. |
Rabbit Polyclonal Anti-TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the C terminal of human TRPC6. Synthetic peptide located within the following region: GHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRS |
Goat Polyclonal Antibody against TRPC6 (C-terminal)
Applications | WB |
Reactivities | Human |
Immunogen | Peptide with sequence C-EKLSMEPNQEETNR, from the C Terminus of the protein sequence according to NP_004612.2. |
Rabbit Polyclonal Anti-TRPC6 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the middle region of human TRPC6. Synthetic peptide located within the following region: KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE |
Anti-TRPC6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 919-931 amino acids of human transient receptor potential cation channel, subfamily C, member 6 |
Anti-TRPC6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 919-931 amino acids of human transient receptor potential cation channel, subfamily C, member 6 |
TRPC6 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 732-931 of human TRPC6 (NP_004612.2). |
Modifications | Unmodified |
TRPC6 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human TRPC6 (NP_004612.2). |
Modifications | Unmodified |