Antibodies

View as table Download

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.

CCL5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCL5

Rabbit anti-CCL5 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CCL5

Anti-Murine RANTES Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine RANTES (CCL5)

Anti-Human RANTES Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human RANTES (CCL5)

Anti-Rat RANTES Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Rat
Immunogen E.coli derived Recombinant Rat RANTES (CCL5)

Rabbit Polyclonal Anti-CCL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN

Biotinylated Anti-Human RANTES Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human RANTES (CCL5)

Biotinylated Anti-Murine RANTES Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine RANTES (CCL5)

Biotinylated Anti-Rat RANTES Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Rat
Immunogen E.coli derived Recombinant Rat RANTES (CCL5)

CCL5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCL5