Mouse Monoclonal anti-SCN10A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal anti-SCN10A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-Nav1.7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-SCN2B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SCN2B. |
Rabbit polyclonal anti-SCN9A antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SCN9A. |
Rabbit Polyclonal Anti-Human NaV1.5
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | GST fusion protein with amino acid residues 1978-2016 of human Nav1.5. Intracellular, C-terminus. |
Rabbit polyclonal SCN4B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SCN4B. |
Rabbit polyclonal Anti-SCN3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B. Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND |
Rabbit Polyclonal Anti-SCN9A Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SCN9A / Nav1.7 antibody was raised against synthetic 17 amino acid peptide from internal region of human SCN9A / Nav1.7. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Panda, Dog, Bovine, Horse, Rabbit, Pig (94%); Rat, Hamster, Bat (88%); Elephant, Platypus (82%). |
Rabbit Polyclonal SCN3B Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal Sodium Channel-pan antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human sodium channel. |
Rabbit Polyclonal Anti-SCN5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCN5A antibody is: synthetic peptide directed towards the C-terminal region of Human SCN5A. Synthetic peptide located within the following region: VMSENFSRPLGPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSED |
Rabbit Polyclonal Anti-GRIN2A Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
Rabbit Polyclonal Anti-SCN5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the C terminal of human SCN5A. Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM |
Rabbit Polyclonal Anti-Scn1b Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Scn1b antibody is: synthetic peptide directed towards the N-terminal region of Rat Scn1b. Synthetic peptide located within the following region: TFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF |
Rabbit Anti-NMDA NR2A Subunit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |
Rabbit Anti-NMDA NR2A Subunit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |
Rabbit Polyclonal Anti-SCN5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the N terminal of human SCN5A. Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH |
Rabbit Polyclonal Anti-SCN1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCN1B antibody: synthetic peptide directed towards the middle region of human SCN1B. Synthetic peptide located within the following region: NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS |
Rabbit Polyclonal Anti-SCN8A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCN8A antibody: synthetic peptide directed towards the middle region of human SCN8A. Synthetic peptide located within the following region: ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC |
Mouse monoclonal Anti-Nav 1.5 Clone 4G8:1G7
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCN5A mouse monoclonal antibody,clone OTI5E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCN5A mouse monoclonal antibody,clone OTI4B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-SCN5A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit |
Anti-SCN5A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit |
Anti-SCN2A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 30-43 amino acids of human sodium channel, voltage-gated, type II, alpha subunit |
Anti-SCN2A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 30-43 amino acids of human sodium channel, voltage-gated, type II, alpha subunit |
Anti-SCN1A/2A/3A/4A/5A/8A/9A/10A/11A/12A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1503-1520 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit |
Anti-SCN1A/2A/3A/4A/5A/8A/9A/10A/11A/13A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1503-1520 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit |
Anti-SCN11A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 29-41 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit |
Anti-SCN11A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 29-41 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit |
Anti-SCN10A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 31-45 amino acids of human sodium channel, voltage-gated, type X, alpha subunit |
Anti-SCN10A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 31-45 amino acids of human sodium channel, voltage-gated, type X, alpha subunit |
Anti-SCN9A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 25-38 amino acids of human sodium channel, voltage-gated, type IX, alpha subunit |
Anti-SCN9A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 25-38 amino acids of human sodium channel, voltage-gated, type IX, alpha subunit |
Rabbit Polyclonal Anti-GRIN2A Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GRIN2A |
Rabbit Polyclonal Anti-SCN1B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SCN1B |
Rabbit Polyclonal Anti-SCN9A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SCN9A |
SCN5A mouse monoclonal antibody,clone OTI5E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
SCN5A mouse monoclonal antibody,clone OTI5E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
SCN5A mouse monoclonal antibody,clone OTI4B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
SCN5A mouse monoclonal antibody,clone OTI4B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-GRIN2A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIN2A |
Rabbit Polyclonal anti-GRIN2A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIN2A |