Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-NR1I3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NR1I3. |
Rabbit Polyclonal Anti-NR1I3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the N terminal of human NR1I3. Synthetic peptide located within the following region: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA |
Rabbit Polyclonal Anti-NR1I3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the middle region of human NR1I3. Synthetic peptide located within the following region: PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG |
Rabbit Polyclonal Anti-NR1I3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of human NR1I3. Synthetic peptide located within the following region: FHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQS |
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI9E4 (formerly 9E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI9E1 (formerly 9E1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 159.00
2 Days
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI9E4 (formerly 9E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI9E4 (formerly 9E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 159.00
2 Days
USD 379.00
In Stock
USD 159.00
2 Days
USD 379.00
In Stock
USD 159.00
In Stock
USD 379.00
In Stock
USD 159.00
2 Days
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI9E1 (formerly 9E1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI9E1 (formerly 9E1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NR1I3
Conjugates
- Unconjugated
Families
- Transcription Factors