Antibodies

View as table Download

CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700027

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)

Reactivities Human
Conjugation Unconjugated

Rabbit anti CD154 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to aa 51-69 of human CD154.

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CD40LG

CD40L Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 47-223 of human CD40L (NP_000065.1).
Modifications Unmodified

CD40L Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 79-129 of human CD40L (NP_000065.1).
Modifications Unmodified

Recombinant Anti-CD40L (Clone hu5c8 (Ruplizumab))

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Modifications NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar.

Recombinant Anti-CD40L (Clone hu5c8 (Ruplizumab))

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-CD40L (Clone hu5c8 (Ruplizumab))

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Modifications NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-CD154 (Clone YMF323.6)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-CD154 (Clone YMF323.6)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-CD40L (Clone AT161-8)

Applications FC, IF
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-CD40L (Clone AT161-8)

Applications FC, IF
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-CD40L (Clone AT161-10)

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-CD40L (Clone AT161-10)

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-CD154 (Clone IDEC-131 (Toralizumab))

Applications IF
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-CD154 (Clone IDEC-131 (Toralizumab))

Applications IF
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-CD40 (Clone chi220)

Reactivities Human
Conjugation Unconjugated

Recombinant Anti-CD40 (Clone chi220)

Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.