ANXA1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANXA1 |
ANXA1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANXA1 |
Rabbit Polyclonal Annexin A1 Antibody
Applications | ELISA, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Mouse Monoclonal Annexin A1 Antibody (2F1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ANXA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA1 antibody: synthetic peptide directed towards the N terminal of human ANXA1. Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD |
Goat Anti-Annexin I Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQAILDETKGDYEK, from the C Terminus of the protein sequence according to NP_000691.1. |
Carrier-free (BSA/glycerol-free) ANXA1 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ANXA1 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ANXA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Annexin A1 Rabbit monoclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".