Anti-ABCG2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Anti-ABCG2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Rabbit Polyclonal Anti-ABCB9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCB9 Antibody: synthetic peptide directed towards the N terminal of human ABCB9. Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW |
Rabbit Polyclonal Anti-ABCA5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCA5 Antibody: synthetic peptide directed towards the C terminal of human ABCA5. Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI |
Rabbit Polyclonal Anti-ABCC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC3 Antibody: synthetic peptide directed towards the middle region of human ABCC3. Synthetic peptide located within the following region: KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL |
Rabbit Polyclonal Anti-ABCD3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCD3 Antibody: synthetic peptide directed towards the N terminal of human ABCD3. Synthetic peptide located within the following region: LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD |
Goat Anti-ABCB9 / TAPL Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GHNEPVANGSHKA, from the C Terminus of the protein sequence according to NP_062570.1; NP_062571.1; NP_982269.1. |
Goat Anti-ABCD3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PDGREDQKRKGISD, from the internal region of the protein sequence according to NP_002849.1. |
Rabbit anti-ABCA1 polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCA1. |
Rabbit anti-ABCA6 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCA6. |
Rabbit anti-ABCB9 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from human ABCB9. |
Rabbit polyclonal anti-ABCB6 antibody
Applications | WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 440-455 of human ABCB6 protein. |
Anti-ABCA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.2253~2257(D-E-K-V-K) derived from Human ABCA1. |
Rabbit Polyclonal Anti-Abcc12 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abcc12 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ |
Rabbit Polyclonal Anti-Abcb10 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA |
Rabbit Polyclonal Anti-Abcb10 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD |
Rabbit Polyclonal Anti-Abcb8 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abcb8 Antibody is: synthetic peptide directed towards the middle region of Mouse Abcb8. Synthetic peptide located within the following region: ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN |
Rabbit Polyclonal Anti-ABCB8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCB8 Antibody: synthetic peptide directed towards the middle region of human ABCB8. Synthetic peptide located within the following region: EPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVG |
Rabbit Polyclonal Anti-ABCC9 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC9 Antibody: synthetic peptide directed towards the middle region of human ABCC9. Synthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK |
Rabbit Polyclonal Anti-Abca1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abca1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK |
Rabbit Polyclonal Anti-ABCD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the N terminal of human ABCD2. Synthetic peptide located within the following region: FIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQT |
Rabbit Polyclonal Anti-ABCD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the middle region of human ABCD2. Synthetic peptide located within the following region: WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT |
Rabbit Polyclonal Anti-ABCD4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the N terminal of human ABCD4. Synthetic peptide located within the following region: YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL |
Rabbit Polyclonal Anti-ABCD4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the C terminal of human ABCD4. Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA |
Rabbit Polyclonal Anti-ABCC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC1 Antibody: synthetic peptide directed towards the middle region of human ABCC1. Synthetic peptide located within the following region: LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA |
Rabbit Polyclonal Anti-ABCA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCA2 Antibody is: synthetic peptide directed towards the N-terminal region of Human ABCA2. Synthetic peptide located within the following region: ILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPS |
Rabbit Polyclonal Anti-ABCB7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCB7 Antibody is: synthetic peptide directed towards the C-terminal region of Human ABCB7. Synthetic peptide located within the following region: DEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQG |
Rabbit Polyclonal Anti-ABCC11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC11 Antibody: synthetic peptide directed towards the middle region of human ABCC11. Synthetic peptide located within the following region: NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH |
Anti-ABCC12 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 11-25 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 12 |
Anti-ABCG5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 18-30 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 5 |
Anti-ABCB9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 9 |
Anti-ABCB8 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8 |
Anti-ABCB8 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8 |
Anti-ABCC5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human ATP-binding cassette, sub-family C? |
Anti-ABCB6 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Anti-ABCB6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Anti-ABCD2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 274-288 amino acids of human ATP-binding cassette, sub-family D (ALD), member 2 |
Anti-ABCD4 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4 |
Anti-ABCD4 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4 |
Anti-ABCC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
Anti-ABCC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
Anti-ABCG1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 349-362 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 1 |
Anti-ABCG2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 609-621 amino acids of Human ATP-binding cassette sub-family G member 2 |
Anti-ABCC3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 881-894 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 3 |
Anti-ABCB11 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1308-1321 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 11 |
Anti-ABCB11 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1308-1321 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 11 |
Anti-ABCA2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 113-127 amino acids of human ATP-binding cassette, sub-family A (ABC1), member 2 |
Anti-CFTR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 681-897 amino acids of Human Cystic fibrosis transmembrane conductance regulator |
Anti-CFTR Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 681-897 amino acids of Human Cystic fibrosis transmembrane conductance regulator |
Anti-ABCA4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2260-2273 amino acids of human ATP-binding cassette, sub-family A (ABC1), member 4 |
Anti-ABCG4 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 250 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 4 |