Antibodies

View as table Download

Anti-ABCG2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338).

Rabbit Polyclonal Anti-ABCB9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCB9 Antibody: synthetic peptide directed towards the N terminal of human ABCB9. Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW

Rabbit Polyclonal Anti-ABCA5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCA5 Antibody: synthetic peptide directed towards the C terminal of human ABCA5. Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI

Rabbit Polyclonal Anti-ABCC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC3 Antibody: synthetic peptide directed towards the middle region of human ABCC3. Synthetic peptide located within the following region: KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL

Rabbit Polyclonal Anti-ABCD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD3 Antibody: synthetic peptide directed towards the N terminal of human ABCD3. Synthetic peptide located within the following region: LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD

Goat Anti-ABCB9 / TAPL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GHNEPVANGSHKA, from the C Terminus of the protein sequence according to NP_062570.1; NP_062571.1; NP_982269.1.

Goat Anti-ABCD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PDGREDQKRKGISD, from the internal region of the protein sequence according to NP_002849.1.

Rabbit anti-ABCA1 polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABCA1.

Rabbit anti-ABCA6 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABCA6.

Rabbit anti-ABCB9 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from human ABCB9.

Rabbit polyclonal anti-ABCB6 antibody

Applications WB
Reactivities Human, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 440-455 of human ABCB6 protein.

Anti-ABCA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.2253~2257(D-E-K-V-K) derived from Human ABCA1.

Rabbit Polyclonal Anti-Abcc12 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abcc12 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ

Rabbit Polyclonal Anti-Abcb10 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA

Rabbit Polyclonal Anti-Abcb10 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD

Rabbit Polyclonal Anti-Abcb8 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abcb8 Antibody is: synthetic peptide directed towards the middle region of Mouse Abcb8. Synthetic peptide located within the following region: ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN

Rabbit Polyclonal Anti-ABCB8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCB8 Antibody: synthetic peptide directed towards the middle region of human ABCB8. Synthetic peptide located within the following region: EPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVG

Rabbit Polyclonal Anti-ABCC9 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC9 Antibody: synthetic peptide directed towards the middle region of human ABCC9. Synthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK

Rabbit Polyclonal Anti-Abca1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abca1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK

Rabbit Polyclonal Anti-ABCD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the N terminal of human ABCD2. Synthetic peptide located within the following region: FIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQT

Rabbit Polyclonal Anti-ABCD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the middle region of human ABCD2. Synthetic peptide located within the following region: WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT

Rabbit Polyclonal Anti-ABCD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the N terminal of human ABCD4. Synthetic peptide located within the following region: YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL

Rabbit Polyclonal Anti-ABCD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the C terminal of human ABCD4. Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA

Rabbit Polyclonal Anti-ABCC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC1 Antibody: synthetic peptide directed towards the middle region of human ABCC1. Synthetic peptide located within the following region: LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA

Rabbit Polyclonal Anti-ABCA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCA2 Antibody is: synthetic peptide directed towards the N-terminal region of Human ABCA2. Synthetic peptide located within the following region: ILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPS

Rabbit Polyclonal Anti-ABCB7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCB7 Antibody is: synthetic peptide directed towards the C-terminal region of Human ABCB7. Synthetic peptide located within the following region: DEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQG

Rabbit Polyclonal Anti-ABCC11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC11 Antibody: synthetic peptide directed towards the middle region of human ABCC11. Synthetic peptide located within the following region: NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH

Anti-ABCC12 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 11-25 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 12

Anti-ABCG5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-30 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 5

Anti-ABCB9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 9

Anti-ABCB8 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8

Anti-ABCB8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8

Anti-ABCC5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human ATP-binding cassette, sub-family C?

Anti-ABCB6 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6

Anti-ABCB6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6

Anti-ABCD2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 274-288 amino acids of human ATP-binding cassette, sub-family D (ALD), member 2

Anti-ABCD4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4

Anti-ABCD4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4

Anti-ABCC1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1

Anti-ABCC1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1

Anti-ABCG1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 349-362 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 1

Anti-ABCG2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 609-621 amino acids of Human ATP-binding cassette sub-family G member 2

Anti-ABCC3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 881-894 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 3

Anti-ABCB11 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1308-1321 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 11

Anti-ABCB11 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1308-1321 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 11

Anti-ABCA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 113-127 amino acids of human ATP-binding cassette, sub-family A (ABC1), member 2

Anti-CFTR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 681-897 amino acids of Human Cystic fibrosis transmembrane conductance regulator

Anti-CFTR Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 681-897 amino acids of Human Cystic fibrosis transmembrane conductance regulator

Anti-ABCA4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2260-2273 amino acids of human ATP-binding cassette, sub-family A (ABC1), member 4

Anti-ABCG4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 250 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 4