Germany
Japan
United Kingdom
China
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Antibodies
View as table Download
Goat Polyclonal Antibody against ABCC8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2. |
Rabbit Polyclonal Anti-ABCG2(CD338) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Rabbit Polyclonal ABCA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
Goat Polyclonal Antibody against ABCC5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KDIDIGKEYIIP-C, from the N Terminus of the protein sequence according to NP_005679.2; NP_001018881.1. |
Goat Anti-ABCC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQSDLKVDENQKAYY, from the internal region of the protein sequence according to NP_004987.2; NP_063915.2; NP_063953.2;NP_063954.2; NP_063955.2. |
Rabbit polyclonal anti-ABCB1 antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 262-277 of human ABCB1 protein. |
Rabbit anti-ABCD4 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ABCD4. |
Anti-ABCG2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Goat Anti-ABCD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PDGREDQKRKGISD, from the internal region of the protein sequence according to NP_002849.1. |
Anti-ABCA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.2253~2257(D-E-K-V-K) derived from Human ABCA1. |
Rabbit Polyclonal Anti-Abcb10 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) Purified ABCB1 mouse monoclonal antibody, clone OTI3C8 (formerly 3C8)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI4F3 (formerly 4F3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI5E3 (formerly 5E3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABCD1 mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Rat
Families
- Druggable Genome
Pathways
- ABC transporters
Filter by
Category
Target Symbol
- ABCB1 (163)
- ABCC5 (33)
- ABCD1 (30)
- ABCD2 (7)
- ABCC2 (5)
- ABCD4 (4)
- CFTR (4)
- ABCA1 (3)
- ABCC1 (3)
- ABCG1 (3)
- ABCG2 (3)
- TAP2 (3)
- ABCB11 (2)
- ABCB5 (2)
- ABCB6 (2)
- ABCB8 (2)
- ABCB9 (2)
- ABCC4 (2)
- ABCC8 (2)
- ABCD3 (2)
- ABCA2 (1)
- ABCA4 (1)
- ABCB10 (1)
- ABCB7 (1)
- ABCC10 (1)
- ABCC12 (1)
- ABCC3 (1)
- ABCC9 (1)
- ABCG4 (1)
- ABCG5 (1)