Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Monoclonal Beclin 1/ATG6 Antibody (9B6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Equine, Porcin |
| Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal beta-Arrestin 2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1. |
Rabbit Polyclonal NFkB p65 NLS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody. |
Rabbit Polyclonal RUNX2/CBFA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to somewhere between amino acids 250-300 of human RUNX2 was used as immunogen for this antibody.RUNX2 and RUNX1 share an approximate 66% homology in peptide sequence used as immunogen. |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Rabbit Polyclonal SUMO3 Antibody
| Applications | WB |
| Reactivities | Equine, Human, Mouse, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 50-95 of human SUMO3 (SMT3) was used as the immunogen for this antibody. |
Active filters
Reactivities
- Equine
Families
- Druggable Genome
Filter by
Category
Target Symbol
Antibody Hosts
Isotypes
Clonalities
Conjugates
Pathways
- Apoptosis (2)
- Chemokine signaling pathway (2)
- MAPK signaling pathway (2)
- Pathways in cancer (2)
- Small cell lung cancer (2)
- Toll-like receptor signaling pathway (2)
- p53 signaling pathway (2)
- Acute myeloid leukemia (1)
- Adherens junction (1)
- Adipocytokine signaling pathway (1)
- Alzheimer's disease (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- B cell receptor signaling pathway (1)
- Cell cycle (1)
- Chronic myeloid leukemia (1)
- Colorectal cancer (1)
- Cytosolic DNA-sensing pathway (1)
- Endocytosis (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Huntington's disease (1)
- NOD-like receptor signaling pathway (1)
- Neurotrophin signaling pathway (1)
- Olfactory transduction (1)
- Pancreatic cancer (1)
- Parkinson's disease (1)
- Prostate cancer (1)
- RIG-I-like receptor signaling pathway (1)
- Regulation of autophagy (1)
- T cell receptor signaling pathway (1)
- Viral myocarditis (1)