Antibodies

Jump to Filters
View as table Download
IKB zeta (NFKBIZ) Rabbit Polyclonal Antibody
TA336346

USD 402.00

5 Days

Rabbit Polyclonal IKB zeta Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to an amino acid range between 270-320 and 670-720 of mouse IkB zeta protein were used as the immunogen for this antibody.
IKB zeta (NFKBIZ) Rabbit Polyclonal Antibody
TA344659

USD 475.00

5 Days

Rabbit Polyclonal Anti-Nfkbiz Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Nfkbiz antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
IKB zeta (NFKBIZ) Mouse Monoclonal Antibody [Clone ID: OTI1E8]
CF502768

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NFKBIZ mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated
IKB zeta (NFKBIZ) Mouse Monoclonal Antibody [Clone ID: OTI1E8]
TA502768

USD 379.00

In Stock

NFKBIZ mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated
IKB zeta (NFKBIZ) Mouse Monoclonal Antibody [Clone ID: OTI1E8]
TA502768S

USD 159.00

In Stock

NFKBIZ mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated