STEAP4 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | STEAP4 antibody was raised against synthetic peptide from human STEAP4. |
STEAP4 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | STEAP4 antibody was raised against synthetic peptide from human STEAP4. |
STEAP4 rabbit polyclonal antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Immunogen | STEAP4 antibody was raised against synthetic peptide - KLH conjugated |
Goat Polyclonal Antibody against STEAP4 / Dudulin4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CVDNTLTRIRQGWERN, from the C Terminus of the protein sequence according to NP_078912.2. |
Rabbit polyclonal STEAP4 antibody [#C11207]
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human STEAP4. |
Rabbit Polyclonal STEAP4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | STEAP4 antibody was raised against a 14 amino acid peptide from near the center of human STEAP4. |
Rabbit Polyclonal Anti-STEAP4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STEAP4 antibody: synthetic peptide directed towards the C terminal of human STEAP4. Synthetic peptide located within the following region: AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA |
Rabbit Polyclonal Anti-STEAP4 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | STEAP4 antibody was raised against synthetic 15 amino acid peptide from N-Terminus of human STEAP4. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey, Marmoset (93%); Gibbon, Mouse, Bat, Horse (87%); Hamster, Elephant, Panda, Rabbit, Pig, Xenopus (80%). |
Anti-STEAP4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 441-456 amino acids of human STEAP family member 4 |
Anti-STEAP4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 441-456 amino acids of human STEAP family member 4 |